BYKdb

Annotate results for A0A0C5BB48

A0A0C5BB48 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C5BB48
DOMAINtad5/148DTVELRDVLRLLRDHWLAIVAAILLGTLFAFAWSQLQTPRYEANSQGIVSVATSGTSSDQ
NQAIYTRQIADSVAKSSLATYLPIATSRAVAEIAIQKLGLDESPESVISAISVTSDTTAP
VLKVTASASRPDAAQTLADAWVSA
DOMAINcd288/477TSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAKSFGLVPGVGLTDLLIGKAE
LQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIIDAPPLLPVTD
GAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQLGRGYGYY
YTTYYGSERS
SITE-425/-427GKT
SITEWalker A'315/322VVVDGDLR
SITEWalker B395/401VIIDAPP
SITEY Cluster464/472YGYYYTTYY
SITEWalker A295/297GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKELDTVELRDVLRLLRDHWLAIVAAILLGTLFAFAWSQLQTPRYEANSQGIVSVATSGTSSDQNQAIYTRQIADSVAKS
    DTVELRDVLRLLRDHWLAIVAAILLGTLFAFAWSQLQTPRYEANSQGIVSVATSGTSSDQNQAIYTRQIADSVAKS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLATYLPIATSRAVAEIAIQKLGLDESPESVISAISVTSDTTAPVLKVTASASRPDAAQTLADAWVSAIATRIQQINKET
SLATYLPIATSRAVAEIAIQKLGLDESPESVISAISVTSDTTAPVLKVTASASRPDAAQTLADAWVSA            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIGNSVSLSVVQAAALPAAPAFPNLRLVLAVGALIGLVIGLVYAFIRNTLDRRIRTAEMVERLFELPVVGTLPVDKRLSE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNRIVPEADTTDYVKSDGKHALAESLRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGD
                                               TSPLPSDGKSTVTANLAVTLAASGQRTVVVDGD
                                                      GKS                 VVVDGD
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRKPTVAKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIIDAP
LRKPTVAKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIIDAP
LR                                                                        VIIDAP
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLLPVTDGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQLGRGYGYYYTTYYGSERSGAR
PLLPVTDGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQLGRGYGYYYTTYYGSERS   
P                                                              YGYYYTTYY        
       490  
....:....|..
PEPVNDPVPSSV


© 1998-2019