BYKdb

Annotate results for A0A0C5CFM3

A0A0C5CFM3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0C5CFM3
DOMAINcd30/210TSSGPGEGKSTIVGNLAVVFAQQGKRVLLVDADLRRPTVHYTFGMTNTFGLTTVLTKQGT
LLETVSKCDVENLHLLPSGPIPPNPAELLSSRAMKEFLKEAKEQYDIILLDTPPVLAVTD
AQVLTNQCDGTILVVSSGKAEVEAVKKAKELLESANANLLGVVLNNKKTQNTHYYYYYGK
D
SITEWalker A37/39GKS
SITEWalker A'57/64LLVDADLR
SITEWalker B137/143ILLDTPP
SITEY Cluster203/207YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSPISEQFRTIRTNISFSSVDNDLQLLMVTSSGPGEGKSTIVGNLAVVFAQQGKRVLLVDADLRRPTVHYTFGMTNTFGL
                             TSSGPGEGKSTIVGNLAVVFAQQGKRVLLVDADLRRPTVHYTFGMTNTFGL
                                    GKS                 LLVDADLR                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTVLTKQGTLLETVSKCDVENLHLLPSGPIPPNPAELLSSRAMKEFLKEAKEQYDIILLDTPPVLAVTDAQVLTNQCDGT
TTVLTKQGTLLETVSKCDVENLHLLPSGPIPPNPAELLSSRAMKEFLKEAKEQYDIILLDTPPVLAVTDAQVLTNQCDGT
                                                        ILLDTPP                 
       170       180       190       200       210
....:....|....:....|....:....|....:....|....:....|
ILVVSSGKAEVEAVKKAKELLESANANLLGVVLNNKKTQNTHYYYYYGKD
ILVVSSGKAEVEAVKKAKELLESANANLLGVVLNNKKTQNTHYYYYYGKD
                                          YYYYY   
© 1998-2019