BYKdb

Annotate results for A0A0C5KWV7

A0A0C5KWV7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C5KWV7
DOMAINtad20/177ASLEIQEILRILREQYRTILACIAGGLLVTGALSLLSAPLYRSSALLQYDPSATEPIEQS
RTMMLRSAVMNQEMVATQVGLLRSDALAMRVAERLNLAGQPGYGGTIGSREDRLQRAASR
LKGAIQVEAIKSSLLLRVSVSAGNAELSTQLTNALAEE
DOMAINcd521/705TSSFPGEGKSTTAFAIAALSARLGRRVLLIDADLRRPTFHGKGRGVGLANLLASERPATD
FIESMEIDNLSLMPAGQVSDSAAELLSSARLPAIVAEVRDRFDLIVLDGPPVLGLTDAPL
LASVVDATMIVIESGKIRTPNVANAVRRVREAGGRVIGVVLTKVTQRNADSGGYGYYEYQ
SSTAS
SITEWalker A528/530GKS
SITEWalker A'548/555LLIDADLR
SITEWalker B625/631IVLDGPP
SITEY Cluster694/699YGYYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIHAATSNQPQETGVETEAASLEIQEILRILREQYRTILACIAGGLLVTGALSLLSAPLYRSSALLQYDPSATEPIEQSR
                   ASLEIQEILRILREQYRTILACIAGGLLVTGALSLLSAPLYRSSALLQYDPSATEPIEQSR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMMLRSAVMNQEMVATQVGLLRSDALAMRVAERLNLAGQPGYGGTIGSREDRLQRAASRLKGAIQVEAIKSSLLLRVSVS
TMMLRSAVMNQEMVATQVGLLRSDALAMRVAERLNLAGQPGYGGTIGSREDRLQRAASRLKGAIQVEAIKSSLLLRVSVS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGNAELSTQLTNALAEEFIASSLERRYSSSSYARKFLSDQLAKTKLALEQSERNVNDYAIQARLFRRPGQAADGKVSDEG
AGNAELSTQLTNALAEE                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTLSAVDLAALQDALNQARVRRVAAETAWRAGASERPASNEAAISPLIQQRAQLQAQYALNLKLFKPDYPAMREIQAQIA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLDDQIARERAEGTGETGRALRAAYQAALRAEQVLDVRFDAAKVEMRGERSRSIQYNILQREADTNRSQYEALLQRYKDV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVAGGIGQSNISLADPPRVPQRPYRPNWPVNLMLGLFAGLAIGVVAAFTANLLFDTIVVGADVRRKLGLRLLGAVPLDRN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLELDVALANRKSAIAEAYYSTLTGLKFARPEGMPGTLSITSSFPGEGKSTTAFAIAALSARLGRRVLLIDADLRRPTFH
                                        TSSFPGEGKSTTAFAIAALSARLGRRVLLIDADLRRPTFH
                                               GKS                 LLIDADLR     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKGRGVGLANLLASERPATDFIESMEIDNLSLMPAGQVSDSAAELLSSARLPAIVAEVRDRFDLIVLDGPPVLGLTDAPL
GKGRGVGLANLLASERPATDFIESMEIDNLSLMPAGQVSDSAAELLSSARLPAIVAEVRDRFDLIVLDGPPVLGLTDAPL
                                                                IVLDGPP         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LASVVDATMIVIESGKIRTPNVANAVRRVREAGGRVIGVVLTKVTQRNADSGGYGYYEYQSSTASESARFDPNASETKAP
LASVVDATMIVIESGKIRTPNVANAVRRVREAGGRVIGVVLTKVTQRNADSGGYGYYEYQSSTAS               
                                                     YGYYEY                     
        
....:...
AVARVQRT


© 1998-2019