BYKdb

Annotate results for A0A0C5L7Q6

A0A0C5L7Q6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C5L7Q6
DOMAINtad38/206LSMKLTEMLWVLSRNRWLAGAVVVIGLALSIVATVLSTPLYRATASVQINQQMPTILEGA
DVEPAVAMSDANRFIEGQRRVLTSRTLARRVVDELGLARTTAFAKTMGARRVDGGSSKAA
LEARREQAIDLMLANLDAKLPISSRVADISFDSPDPALAARVANRYADS
DOMAINcd552/740ISTLPGEGKTTSAIAIARSMAAVGQNVLLVDGDMRVPSLHRVLDLDNAVGLSSILTNQSA
IQGAVQGSELLGFDILTSGPIPPNPVQLLSGEALGQAMTEFAAYDNVVIDGVPVSGFADA
LLYANTVDGVVFLVESGRAKTAQIKATLRRIMSVGVTPIGVLLTKFDPRHAGYSYAYDSY
YHKNEPATI
SITEWalker A559/561GKT
SITEWalker A'579/586LLVDGDMR
SITEWalker B658/664VVIDGVP
SITEY Cluster724/732YSYAYDSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTGYRPTDDAVGYPLTGGHGRDVLENVLLDDSEGSSRLSMKLTEMLWVLSRNRWLAGAVVVIGLALSIVATVLSTPLYRA
                                     LSMKLTEMLWVLSRNRWLAGAVVVIGLALSIVATVLSTPLYRA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TASVQINQQMPTILEGADVEPAVAMSDANRFIEGQRRVLTSRTLARRVVDELGLARTTAFAKTMGARRVDGGSSKAALEA
TASVQINQQMPTILEGADVEPAVAMSDANRFIEGQRRVLTSRTLARRVVDELGLARTTAFAKTMGARRVDGGSSKAALEA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RREQAIDLMLANLDAKLPISSRVADISFDSPDPALAARVANRYADSFISMSLETKVGASDYARDFLADQLEESRRRLEES
RREQAIDLMLANLDAKLPISSRVADISFDSPDPALAARVANRYADS                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQKLIDYSRAEGVIDSSQSGGGSAETAEAPPSLSASNLVALNTAYTEARTRRVLAEQELRGMAGASARSLPQALANPTIQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALQQLRAERKAALDDLSQRYIATYPAVRQAAAQVTDLDRSINAQLSEIRASINHSYTVARDQEAALASAVANAQQLALAD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGKRIQYNILKNEVDSNRSFRNTLLQRSREIGAAAALTLNNISIIDRAEVPVRSIYPKPLQNLAIGLALSFALAVVLILG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REAFQDVIRTPEDVRAKLGLPVIGIVPLATKGMDVLPQLKMPKSPLTEAYNAARTSLEFATATGLPRSLLLISTLPGEGK
                                                                       ISTLPGEGK
                                                                              GK
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTSAIAIARSMAAVGQNVLLVDGDMRVPSLHRVLDLDNAVGLSSILTNQSAIQGAVQGSELLGFDILTSGPIPPNPVQLL
TTSAIAIARSMAAVGQNVLLVDGDMRVPSLHRVLDLDNAVGLSSILTNQSAIQGAVQGSELLGFDILTSGPIPPNPVQLL
T                 LLVDGDMR                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGEALGQAMTEFAAYDNVVIDGVPVSGFADALLYANTVDGVVFLVESGRAKTAQIKATLRRIMSVGVTPIGVLLTKFDPR
SGEALGQAMTEFAAYDNVVIDGVPVSGFADALLYANTVDGVVFLVESGRAKTAQIKATLRRIMSVGVTPIGVLLTKFDPR
                 VVIDGVP                                                        
       730       740       
....:....|....:....|....:..
HAGYSYAYDSYYHKNEPATIDANREAA
HAGYSYAYDSYYHKNEPATI       
   YSYAYDSYY               

© 1998-2019