BYKdb

Annotate results for A0A0C5VQ86

A0A0C5VQ86 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0C5VQ86
DOMAINcd69/245TAPTPGAGKSMISVNLAISIAMEVNQTVLLVDMDFRKPSIHKYFSVKPKYGLQDCLQSGV
PIEDVLFNPGFNRLVVLPGRQGIMSSSELISSPESTQLIRELKEKYDQRLVIFDLPPLFV
SDDVMVFLPNVDCSLLVVESGRNNKDEVQKSVELLKSKPLLGTVLNKEAVSQKIYFY
SITEWalker A76/78GKS
SITEWalker A'97/104LLVDMDFR
SITEWalker B179/185VIFDLPP
SITEY Cluster243/245YFY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAHSDKTASSIKNIEYTQTKILPVSADKLRANRIVAHDPTDPNASLFQVLRTKVLQEMRLNNWNTLAITAPTPGAGKSMI
                                                                    TAPTPGAGKSMI
                                                                           GKS  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVNLAISIAMEVNQTVLLVDMDFRKPSIHKYFSVKPKYGLQDCLQSGVPIEDVLFNPGFNRLVVLPGRQGIMSSSELISS
SVNLAISIAMEVNQTVLLVDMDFRKPSIHKYFSVKPKYGLQDCLQSGVPIEDVLFNPGFNRLVVLPGRQGIMSSSELISS
                LLVDMDFR                                                        
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PESTQLIRELKEKYDQRLVIFDLPPLFVSDDVMVFLPNVDCSLLVVESGRNNKDEVQKSVELLKSKPLLGTVLNKEAVSQ
PESTQLIRELKEKYDQRLVIFDLPPLFVSDDVMVFLPNVDCSLLVVESGRNNKDEVQKSVELLKSKPLLGTVLNKEAVSQ
                  VIFDLPP                                                       
     
....:
KIYFY
KIYFY
  YFY
© 1998-2019