BYKdb

Annotate results for A0A0C5XC37

A0A0C5XC37 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C5XC37
DOMAINtad26/200SIPILRQYLRMAMRWRYVILGAVAICFLIGLVVTLLMTPQYTASSTIEISRESDKVTDLQ
GVERDASIADQEFYQTQYGLLQSRSLSERVAAELKLIDSPKFFEMFDAESEDPAFKLVNG
RFAPAGRATRQRVAGEILRKHLSVSPTRLSRLVDVSFTSPDAAFSAKVANVWAQN
DOMAINcd540/729TSTRPSEGKSTTCLALASTLARAGKNIILVDGDMRNPSIHQLGGVANRRGLSNFLSGEDD
IPSLLFSMEDLGFVAMSAGPLPPNAAELLTGDRLAHLIGRLLETYDHVIIDSPPVMGLAD
AALIATRVEGVIYAVESHGIRTNLVKDAIGRLLTANVRIIGSVLTKFDAKKAHYGYGYGY
EYGYSYGRKT
SITEWalker A547/549GKS
SITEWalker A'567/574ILVDGDMR
SITEWalker B647/653VIIDSPP
SITEY Cluster713/725YGYGYGYEYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSIVSKLGGDTALAALHQSQSEEASIPILRQYLRMAMRWRYVILGAVAICFLIGLVVTLLMTPQYTASSTIEISRESDK
                         SIPILRQYLRMAMRWRYVILGAVAICFLIGLVVTLLMTPQYTASSTIEISRESDK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTDLQGVERDASIADQEFYQTQYGLLQSRSLSERVAAELKLIDSPKFFEMFDAESEDPAFKLVNGRFAPAGRATRQRVAG
VTDLQGVERDASIADQEFYQTQYGLLQSRSLSERVAAELKLIDSPKFFEMFDAESEDPAFKLVNGRFAPAGRATRQRVAG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EILRKHLSVSPTRLSRLVDVSFTSPDAAFSAKVANVWAQNFIQTNLDRKIQATSYGRNLLQGQLAQLKQKLDESQRQLVS
EILRKHLSVSPTRLSRLVDVSFTSPDAAFSAKVANVWAQN                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YASHAKIINLPAQSGSGESSAERSIVVDDLAALNGALAQATANRIAAQTRYEESGKAGASAQALSNTAINGLRQRRAELA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEYQRLMTQFEPGYPAADAVKAQIDQLDSSIAKEEGRVSNSQLADYRQAQEQEQALKAKVEQLKGDYLDQRRRSIQYNIY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQEVDTNQALYDGLLQRYKEIGVAGGVGVNNIAVVDPAQAPKLPSSPRLLINLAIAILAGLGIGAALAFGLEQIDEGITD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAEVKRALGLPLLGSIPKVDAAPRDILLDRKSDLVDAYLAVQTNLSFSTDHGVPRAFAVTSTRPSEGKSTTCLALASTLA
                                                           TSTRPSEGKSTTCLALASTLA
                                                                  GKS           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAGKNIILVDGDMRNPSIHQLGGVANRRGLSNFLSGEDDIPSLLFSMEDLGFVAMSAGPLPPNAAELLTGDRLAHLIGRL
RAGKNIILVDGDMRNPSIHQLGGVANRRGLSNFLSGEDDIPSLLFSMEDLGFVAMSAGPLPPNAAELLTGDRLAHLIGRL
      ILVDGDMR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LETYDHVIIDSPPVMGLADAALIATRVEGVIYAVESHGIRTNLVKDAIGRLLTANVRIIGSVLTKFDAKKAHYGYGYGYE
LETYDHVIIDSPPVMGLADAALIATRVEGVIYAVESHGIRTNLVKDAIGRLLTANVRIIGSVLTKFDAKKAHYGYGYGYE
      VIIDSPP                                                           YGYGYGYE
       730    
....:....|....
YGYSYGRKTEAQAA
YGYSYGRKT     
YGYSY         

© 1998-2019