BYKdb

Annotate results for A0A0C7NW05

A0A0C7NW05 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C7NW05
DOMAINtad8/161NELTFEDILKIFKKRFWYFFITVVVTVIIALIYLFTTTPIYEASTTLKVGSSQQGSVVDI
FGSQMSSGSSKISTEIELIKSRRNLEKVVDNLHLVDYFKERSDNPENVTKNGVIKYLGDI
ITVSPVKDTNIVKISVQSEDSELARSVADELAIV
DOMAINcd522/713SSAGPSEGKTITASNVAIFYAQNGKKTLLMDGDLRKPRVDKIMRIKNKNLGLVNYLMRRV
PLEKILFKPVESLPNFDVLPAGVLPPNPTSLLTSNEFLELLQTLKEHYEKIIIDLPPIMV
APDAQIVSRYSDGLILVTRYNGTLKPMLKVAYENIVSSEVKLLGTVIVDIDEKTSNYYYY
YYYYSDDGKKVK
SITEWalker A529/531GKT
SITEWalker A'549/556LLMDGDLR
SITEWalker B632/638IIIDLPP
SITEY Cluster698/705YYYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDDGKLDNELTFEDILKIFKKRFWYFFITVVVTVIIALIYLFTTTPIYEASTTLKVGSSQQGSVVDIFGSQMSSGSSKIS
       NELTFEDILKIFKKRFWYFFITVVVTVIIALIYLFTTTPIYEASTTLKVGSSQQGSVVDIFGSQMSSGSSKIS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEIELIKSRRNLEKVVDNLHLVDYFKERSDNPENVTKNGVIKYLGDIITVSPVKDTNIVKISVQSEDSELARSVADELAI
TEIELIKSRRNLEKVVDNLHLVDYFKERSDNPENVTKNGVIKYLGDIITVSPVKDTNIVKISVQSEDSELARSVADELAI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYNDLLKSLSQNEYTSRRKFIEEQIPKAESELNTAQDNLRLFKEENNVFILDEEAKAILQFLVTYDQEINTYQVQLEQSK
V                                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRIEAINDLLKNIDQEIITSETISINPVVSNLRNQIVNIQVQLAGIEGTKSANDPEVLKLKEQLFQAQEMLKKEINTIVT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQLKSINPQYSSLYSQLIEEQANLQVIQGTIQALTSIRNTYQSELVKLPALEQKLMDYEREVKVKENLYVLLLEKLEEAK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAEAGVIGTADIIDLAFVSPTPVKPNKTLTVVISGVLGIFLGILVVFLIEYMDKKLKDENELKSIIKGVPVLGRIPSFEI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQESGELPVLKDPVSPISESYKMLATNISFSTTKEPNTICFSSAGPSEGKTITASNVAIFYAQNGKKTLLMDGDLRKPRV
                                         SSAGPSEGKTITASNVAIFYAQNGKKTLLMDGDLRKPRV
                                                GKT                 LLMDGDLR    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DKIMRIKNKNLGLVNYLMRRVPLEKILFKPVESLPNFDVLPAGVLPPNPTSLLTSNEFLELLQTLKEHYEKIIIDLPPIM
DKIMRIKNKNLGLVNYLMRRVPLEKILFKPVESLPNFDVLPAGVLPPNPTSLLTSNEFLELLQTLKEHYEKIIIDLPPIM
                                                                       IIIDLPP  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAPDAQIVSRYSDGLILVTRYNGTLKPMLKVAYENIVSSEVKLLGTVIVDIDEKTSNYYYYYYYYSDDGKKVKKRKRIDT
VAPDAQIVSRYSDGLILVTRYNGTLKPMLKVAYENIVSSEVKLLGTVIVDIDEKTSNYYYYYYYYSDDGKKVK       
                                                         YYYYYYYY               
    
....
TLKN


© 1998-2019