BYKdb

Annotate results for A0A0C9MX03

A0A0C9MX03 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C9MX03
DOMAINtad22/183VRALWSATISMFRRRWRIFAVVAIVTFTVAAALILMMPWKYEAVARVKIDPSPSAALGQM
SGERPDQNIFDTEVNVMRSRDIALAVVDRLKLASDPAFTKGMKPLPATATQAQREKRDTE
LADRLLGKLSTARDKMTYIVNVGFTASDPRLAADVANAFANE
DOMAINcd530/719LSSLPDEGKTSSALALARICALAGEKVLLIDTDLRRAGLLEAAKIRPEAGLIEVLTGKLP
VDQVLIADQLPGLDLLPVASNSFMAEDLFSGEGMQALLHDMAARYDRIILDTAPLLGVAE
SRTIARLVDAAILVIKWGDTPINAVKSALNGLVQDGVPLVGALFSMVDAGEEAYGALYYS
SKYNAYYRSE
SITEWalker A537/539GKT
SITEWalker A'557/564LLIDTDLR
SITEWalker B637/643IILDTAP
SITEY Cluster703/716YGALYYSSKYNAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLMDHSAEPFVDTAPSTGPGVVRALWSATISMFRRRWRIFAVVAIVTFTVAAALILMMPWKYEAVARVKIDPSPSAALGQ
                     VRALWSATISMFRRRWRIFAVVAIVTFTVAAALILMMPWKYEAVARVKIDPSPSAALGQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSGERPDQNIFDTEVNVMRSRDIALAVVDRLKLASDPAFTKGMKPLPATATQAQREKRDTELADRLLGKLSTARDKMTYI
MSGERPDQNIFDTEVNVMRSRDIALAVVDRLKLASDPAFTKGMKPLPATATQAQREKRDTELADRLLGKLSTARDKMTYI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNVGFTASDPRLAADVANAFANEYIAYSVGRRTGTASRETSYLDQRLAALNQQAMQADARLAQYRAQTGIVSGGDSTVTD
VNVGFTASDPRLAADVANAFANE                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQISPLASQLATAESEAAAAQARLRVARAQIASGGIDAVSAVLNSQVIADLRSQRAQVIQRQGEVVARYGPRHPENIKVT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQLTALDKQIKDEANRIIGGLESEANAAQARAASLRGDMGRLRGQQSTDTRASVIADNYQRQADAAHAAYNKLAEQAQQM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQVARSSLSQAQVIESAVTPDAPTSPNRRMLLMLAGLGAMVLGAMAVVTREVLASGLYSTRDVEALGLPVLASVPRIRSS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLRNAAGERCSAPALLLEKPMSSYAETFRVLRHALSSGPERQGARIVAMLSSLPDEGKTSSALALARICALAGEKVLLID
                                                 LSSLPDEGKTSSALALARICALAGEKVLLID
                                                        GKT                 LLID
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDLRRAGLLEAAKIRPEAGLIEVLTGKLPVDQVLIADQLPGLDLLPVASNSFMAEDLFSGEGMQALLHDMAARYDRIILD
TDLRRAGLLEAAKIRPEAGLIEVLTGKLPVDQVLIADQLPGLDLLPVASNSFMAEDLFSGEGMQALLHDMAARYDRIILD
TDLR                                                                        IILD
       650       660       670       680       690       700       710         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
TAPLLGVAESRTIARLVDAAILVIKWGDTPINAVKSALNGLVQDGVPLVGALFSMVDAGEEAYGALYYSSKYNAYYRSE
TAPLLGVAESRTIARLVDAAILVIKWGDTPINAVKSALNGLVQDGVPLVGALFSMVDAGEEAYGALYYSSKYNAYYRSE
TAP                                                           YGALYYSSKYNAYY   

© 1998-2019