BYKdb

Annotate results for A0A0C9N420

A0A0C9N420 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0C9N420
DOMAINtad1/169MDLIKAYRRHLTLFLAVAGGILALVAAYSWLQTPRYTATATLVIAPQPAQIGAERTSALS
DPAADSSVDTQVELLKSRTLAGLVVDRLGLAEEARFQALVHNPSILERIPGLERPPTPLP
ASARRDAAIDRLASGIEVHRNAQTFMLSLSFEHPDRELATAIVNSYAQE
DOMAINcd515/703TSALPNEGKTTAAIGLARIVAMSGVSVVLVDADMRRPSIANALGLRPAVGLQQVLEGEAR
LDEALLRDLDSPLTILPMVRAGLGGAAALGGAGFDALIEDLKARFDVVIFDASPVLPVVD
GRLVAKKADSTVLLVRWRKTPDAAVEMAIHLLQTLGVKMTGVALSRVDLHALARSGYGDP
AQFMGSYNT
SITEWalker A522/524GKT
SITEWalker A'542/549VLVDADMR
SITEWalker B622/628VIFDASP
SITEY Cluster701/705YNTYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLIKAYRRHLTLFLAVAGGILALVAAYSWLQTPRYTATATLVIAPQPAQIGAERTSALSDPAADSSVDTQVELLKSRTL
MDLIKAYRRHLTLFLAVAGGILALVAAYSWLQTPRYTATATLVIAPQPAQIGAERTSALSDPAADSSVDTQVELLKSRTL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGLVVDRLGLAEEARFQALVHNPSILERIPGLERPPTPLPASARRDAAIDRLASGIEVHRNAQTFMLSLSFEHPDRELAT
AGLVVDRLGLAEEARFQALVHNPSILERIPGLERPPTPLPASARRDAAIDRLASGIEVHRNAQTFMLSLSFEHPDRELAT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIVNSYAQEFVAQSGAVKREGADAAAALLRGQLDEARREVEEADGDLGRYKVAHNLMSVQGGTIAEQQLSSLDGQVALAR
AIVNSYAQE                                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGEAEATARLQTARQQLARGSKGDDLGEALGSPVIQQLRSQRATVSAQAADLGGKYGPKYPPLAAAQRQVADIDAQIEGE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKRTISNLEAQRDVAARRTASLAGSASGARSQVVNNNVASIALGGLQLRSDTAHQSYALLLTRLNEIGAQAASTRSDARI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASLAALPTHPSSPNRPINMLVGALLAIAIGLGVVFMRQGTDRGIRTLEDVEGRLQLPYLAGLPTLNSAVRHIGGSDPISA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDHSGSAYAEGYRNLAASVLQSAAAGTVRTIALTSALPNEGKTTAAIGLARIVAMSGVSVVLVDADMRRPSIANALGLR
                                  TSALPNEGKTTAAIGLARIVAMSGVSVVLVDADMRRPSIANALGLR
                                         GKT                 VLVDADMR           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAVGLQQVLEGEARLDEALLRDLDSPLTILPMVRAGLGGAAALGGAGFDALIEDLKARFDVVIFDASPVLPVVDGRLVAK
PAVGLQQVLEGEARLDEALLRDLDSPLTILPMVRAGLGGAAALGGAGFDALIEDLKARFDVVIFDASPVLPVVDGRLVAK
                                                             VIFDASP            
       650       660       670       680       690       700       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
KADSTVLLVRWRKTPDAAVEMAIHLLQTLGVKMTGVALSRVDLHALARSGYGDPAQFMGSYNTYYAN
KADSTVLLVRWRKTPDAAVEMAIHLLQTLGVKMTGVALSRVDLHALARSGYGDPAQFMGSYNT    
                                                            YNTYY  

© 1998-2019