BYKdb

Annotate results for A0A0C9NVR6

A0A0C9NVR6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0C9NVR6
DOMAINcd62/248TSSAMSEGKSTVSANVAVTWAQAGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKNT
PEQVVETTFVDHLSIITSGPVPPNPSELLNSKRMGKLLDWARNNFDIIVLDAPPVLAVSD
VQVLVPKTDGVVVVANMGKTLKGDLERTVEVLKFANAKILGSVERVKAKHGDRGYGYGYG
YGYGNEK
SITE-199/-201GKT
SITEWalker A'89/96LLIDADLR
SITEWalker B169/175IVLDAPP
SITEY Cluster236/244YGYGYGYGY
SITEWalker A69/71GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNFSLKEILPHHKVDQETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAGAALDVCKVIMFTSSAMSEGKSTVSANVAVT
                                                             TSSAMSEGKSTVSANVAVT
                                                                    GKS         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WAQAGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKNTPEQVVETTFVDHLSIITSGPVPPNPSELLNSKRMGKLLD
WAQAGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKNTPEQVVETTFVDHLSIITSGPVPPNPSELLNSKRMGKLLD
        LLIDADLR                                                                
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WARNNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLERTVEVLKFANAKILGSVERVKAKHGDRGYGYGY
WARNNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLERTVEVLKFANAKILGSVERVKAKHGDRGYGYGY
        IVLDAPP                                                            YGYGY
        
....:...
GYGYGNEK
GYGYGNEK
GYGY    
© 1998-2019