BYKdb

Annotate results for A0A0D0HAF9

A0A0D0HAF9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D0HAF9
DOMAINtad18/271GQLSGRGLLRLMRDHWVEIVGIAAFIAALSVIYVLLAIPIYSADVLVRVDPPDPNEFGLS
SQTRETPPSVPSPDAEMAVMTSRSVLEPVIQRYRFDITVTPRSVPVLGAIAQKLASPGQP
AAPWLGLRSFAWGGEQVRVASLEVPRALEEEKLTLVARDNGRYELFGPSGEPLLAGRVGE
AASSRGVSMKIAELVARPGTNFEVIRWNGLDAVTRFAKSMKVTDRAKGTGLVEITYLDES
PTRAVDVANAISQQ
DOMAINcd582/771TGPTPAAGKSFVAANLAVLHAEIGSRVLLIDADMRGGHLALNFGQPNRDGLSDVLRCEKE
PRDVMREVGGVQGLWFISCGRPAHNSAALLMSRHFKDLLDRFSAEFDLVVIDTPPHPMTD
ADIIASTAGATVLVLRSGMQSEDEIADTVRKLDRAGARVVGAVFNAIPASRGNRYYDYAL
RIGSAESLGT
SITEWalker A589/591GKS
SITEWalker A'609/616LLIDADMR
SITEWalker B690/696VVIDTPP
SITEY Cluster756/759YYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNHLTFNSTPAQRGGEHGQLSGRGLLRLMRDHWVEIVGIAAFIAALSVIYVLLAIPIYSADVLVRVDPPDPNEFGLSSQT
                 GQLSGRGLLRLMRDHWVEIVGIAAFIAALSVIYVLLAIPIYSADVLVRVDPPDPNEFGLSSQT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RETPPSVPSPDAEMAVMTSRSVLEPVIQRYRFDITVTPRSVPVLGAIAQKLASPGQPAAPWLGLRSFAWGGEQVRVASLE
RETPPSVPSPDAEMAVMTSRSVLEPVIQRYRFDITVTPRSVPVLGAIAQKLASPGQPAAPWLGLRSFAWGGEQVRVASLE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPRALEEEKLTLVARDNGRYELFGPSGEPLLAGRVGEAASSRGVSMKIAELVARPGTNFEVIRWNGLDAVTRFAKSMKVT
VPRALEEEKLTLVARDNGRYELFGPSGEPLLAGRVGEAASSRGVSMKIAELVARPGTNFEVIRWNGLDAVTRFAKSMKVT

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRAKGTGLVEITYLDESPTRAVDVANAISQQYIAYAVAARQRTDSATLDFITKELPRLRAELLRSEQALADYQASAQSMQ
DRAKGTGLVEITYLDESPTRAVDVANAISQQ                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTMESQAYLQGGIEFDRQIASLQIQRTQLLERYTPGSRWVTSVDTQIKQLHAAKSAFDARFTSMPVSERRNADLARDAKV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAVYLGMVQKAEELSVRRASTTGGAHIVDDATVPLHPVKPEKLLIIPGGVALGLFCGVMSVFLRRHVMTGVTDPLYVEQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLNIPVVGEVLFSRHQARLDQEMEPPLRRRRVSGGAALMLQRPSARLHRSGSEQQNAVRGHGLTKVLADRFPTDLAVEGL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGVRTALSRDSAQAPNNVVMFTGPTPAAGKSFVAANLAVLHAEIGSRVLLIDADMRGGHLALNFGQPNRDGLSDVLRCEK
                     TGPTPAAGKSFVAANLAVLHAEIGSRVLLIDADMRGGHLALNFGQPNRDGLSDVLRCEK
                            GKS                 LLIDADMR                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPRDVMREVGGVQGLWFISCGRPAHNSAALLMSRHFKDLLDRFSAEFDLVVIDTPPHPMTDADIIASTAGATVLVLRSGM
EPRDVMREVGGVQGLWFISCGRPAHNSAALLMSRHFKDLLDRFSAEFDLVVIDTPPHPMTDADIIASTAGATVLVLRSGM
                                                 VVIDTPP                        
       730       740       750       760       770    
....:....|....:....|....:....|....:....|....:....|....
QSEDEIADTVRKLDRAGARVVGAVFNAIPASRGNRYYDYALRIGSAESLGTAAS
QSEDEIADTVRKLDRAGARVVGAVFNAIPASRGNRYYDYALRIGSAESLGT   
                                   YYDY               

© 1998-2019