BYKdb

Annotate results for A0A0D0HRJ1

A0A0D0HRJ1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D0HRJ1
DOMAINcd53/233TSSAPAEGKSTTVANLAVVFAQQGKKVLLIDADLRKPTVHYTFRKDNYIGLTNVLTKQAT
LQTAVKETDVENLFVLTSGPIPPNPAELLGSATMEELLAEAYDQFNVVLFDTPPVLAVTD
AQILANQCDGTILVVHSGKTDIEAAQKAKELLLAAKGKLLGVVLNQKKQKESSYYYYYGN
K
SITE-190/-192GKT
SITEWalker A'80/87LLIDADLR
SITEWalker B160/166VLFDTPP
SITEY Cluster226/230YYYYY
SITEWalker A60/62GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVLKKKKQVFERTMRSLITKTNPKSPISEQYRTIRTNIQFSVADRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVL
                                                    TSSAPAEGKSTTVANLAVVFAQQGKKVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDADLRKPTVHYTFRKDNYIGLTNVLTKQATLQTAVKETDVENLFVLTSGPIPPNPAELLGSATMEELLAEAYDQFNVV
LIDADLRKPTVHYTFRKDNYIGLTNVLTKQATLQTAVKETDVENLFVLTSGPIPPNPAELLGSATMEELLAEAYDQFNVV
LIDADLR                                                                        V
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
LFDTPPVLAVTDAQILANQCDGTILVVHSGKTDIEAAQKAKELLLAAKGKLLGVVLNQKKQKESSYYYYYGNK
LFDTPPVLAVTDAQILANQCDGTILVVHSGKTDIEAAQKAKELLLAAKGKLLGVVLNQKKQKESSYYYYYGNK
LFDTPP                                                           YYYYY   
© 1998-2019