BYKdb

Annotate results for A0A0D0JNH8

A0A0D0JNH8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D0JNH8
DOMAINtad21/209DYIDLRRIWNAIWMRKWAIVLFVVVITLVTALAVSRMTPVYRAVSTVMIETKGTQLVSFQ
QVYDTTGAVNEYLQTQLGLIKSRGVAEKVVRELNLTEHPDFDPRQQPKPLINVGGFVRSV
QGMLSVTGLVDEPEPATPMTEAELLDIVTKMLMDRTSIWVEGKSQLVSISVELPDRLTAA
QIANSLASN
DOMAINcd553/742TSSSPGEGKSTLVANMAFALSQLQRVLLIDADLRRPTLAKSFDFPVGTPGLANLITGSAK
VEDCIHNMGNNLDMLPAGAVPPNPLELLASPRFAKFLEMIKERYDHIIIDSPPSQAVSDA
SLLSTFADSVIYVIKSEATSIPLAQRGVGHLLQSGASVMGVVLNQVDVEKAARSGDYSGY
YDHYGYSDRK
SITEWalker A560/562GKS
SITEWalker A'579/586LLIDADLR
SITEWalker B659/665IIIDSPP
SITEY Cluster729/738YSGYYDHYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSPARTIRQWQPSPSEADSDYIDLRRIWNAIWMRKWAIVLFVVVITLVTALAVSRMTPVYRAVSTVMIETKGTQLVSFQ
                    DYIDLRRIWNAIWMRKWAIVLFVVVITLVTALAVSRMTPVYRAVSTVMIETKGTQLVSFQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVYDTTGAVNEYLQTQLGLIKSRGVAEKVVRELNLTEHPDFDPRQQPKPLINVGGFVRSVQGMLSVTGLVDEPEPATPMT
QVYDTTGAVNEYLQTQLGLIKSRGVAEKVVRELNLTEHPDFDPRQQPKPLINVGGFVRSVQGMLSVTGLVDEPEPATPMT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAELLDIVTKMLMDRTSIWVEGKSQLVSISVELPDRLTAAQIANSLASNYIDSQLEAQMEMSLSATTWMNTRLTELRSSL
EAELLDIVTKMLMDRTSIWVEGKSQLVSISVELPDRLTAAQIANSLASN                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEAENRLQAYREAEGLVDVNGVATISNNELSLTGDRMIDARRQRAEAESQFRQVESMGSTDWRRLSSVPAVLGNPLIQQF


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KAEEARARAKVEELSRRYGERHPAMAAAKSDLSAASASLRAQVEQVVASIERNYQLAVANENSLNASFNKNKEQIQDISR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEFKVRELTRDVESNRSLYETFMTRLRETAATQDVNSSNARIIDQAIAPIQAAAPNKKLLIVLAAGLALIFGIALAVIRD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILNNTFKSADDVENKLNLPVLGIVPLISTNTKYTAAHLFEHGEDARFCESIRTIRTSLMLADTSRSQKVLVVTSSSPGEG
                                                                        TSSSPGEG
                                                                               G
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSTLVANMAFALSQLQRVLLIDADLRRPTLAKSFDFPVGTPGLANLITGSAKVEDCIHNMGNNLDMLPAGAVPPNPLELL
KSTLVANMAFALSQLQRVLLIDADLRRPTLAKSFDFPVGTPGLANLITGSAKVEDCIHNMGNNLDMLPAGAVPPNPLELL
KS                LLIDADLR                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASPRFAKFLEMIKERYDHIIIDSPPSQAVSDASLLSTFADSVIYVIKSEATSIPLAQRGVGHLLQSGASVMGVVLNQVDV
ASPRFAKFLEMIKERYDHIIIDSPPSQAVSDASLLSTFADSVIYVIKSEATSIPLAQRGVGHLLQSGASVMGVVLNQVDV
                  IIIDSPP                                                       
       730       740   
....:....|....:....|...
EKAARSGDYSGYYDHYGYSDRKA
EKAARSGDYSGYYDHYGYSDRK 
        YSGYYDHYGY     

© 1998-2019