BYKdb

Annotate results for A0A0D0KIA8

A0A0D0KIA8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D0KIA8
DOMAINtad19/279EGINLTEYWDILVDNRWLVAAVVAVFLFLGTAYALLGKPVYEGNLAVQVEDSGNSAGSFL
GDAASSLLSVKTPAAGEIEILRSRAILGKAVENTKLYISARPRYAPFVGSYLSRRATELS
EPGFMGLSGYVTGTEQILVPRLDVPPDFEEKPFTLTLGTNGQYELSNPDIEVPLKGTVGT
LLSANIPNVANGSLGLMVTSISGKPGAQFQLVRSSTQKTLLALQDSLKVVEKGKQSGVLD
VSWKNADPKKLTQLLNEIGTL
DOMAINcd556/750SGATPGVGKTFISVNFAAISAATGKRVLLIDADLRKGRVNQFLSISRAGGLSELIAGTLD
FEKAVRPSVLPNLDVITTGVLPPNPAELLMSESFVHVLDRLSPSYDLVIVDTAPVLVAAD
TASVAPLASTLLLVARAEKTQLGELNETVRRLAHAGRSVNGVILNAIDLSRRHAGSGGYK
YGTYKHLQYSYKSNR
SITEWalker A563/565GKT
SITEWalker A'583/590LLIDADLR
SITEWalker B663/669VIVDTAP
SITEY Cluster734/746YKYGTYKHLQYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNASQQAAPAMQSLDDDGEGINLTEYWDILVDNRWLVAAVVAVFLFLGTAYALLGKPVYEGNLAVQVEDSGNSAGSFLGD
                  EGINLTEYWDILVDNRWLVAAVVAVFLFLGTAYALLGKPVYEGNLAVQVEDSGNSAGSFLGD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AASSLLSVKTPAAGEIEILRSRAILGKAVENTKLYISARPRYAPFVGSYLSRRATELSEPGFMGLSGYVTGTEQILVPRL
AASSLLSVKTPAAGEIEILRSRAILGKAVENTKLYISARPRYAPFVGSYLSRRATELSEPGFMGLSGYVTGTEQILVPRL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVPPDFEEKPFTLTLGTNGQYELSNPDIEVPLKGTVGTLLSANIPNVANGSLGLMVTSISGKPGAQFQLVRSSTQKTLLA
DVPPDFEEKPFTLTLGTNGQYELSNPDIEVPLKGTVGTLLSANIPNVANGSLGLMVTSISGKPGAQFQLVRSSTQKTLLA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQDSLKVVEKGKQSGVLDVSWKNADPKKLTQLLNEIGTLYVRQNMERKAAEAEKTLGFLDTALPQFKTQLEQSEDTYNRY
LQDSLKVVEKGKQSGVLDVSWKNADPKKLTQLLNEIGTL                                         

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNQNGTVSLDDEAKNALTQTVDLQSKLLEAEQKRRELAARFTDEHPAIQTLDTQVKAWKSAIAGIDARIRKMPELQQNTV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RMQRDIKVNTDLYVSLLNSSLQMRLAKEGKVGNVRLLDEAIVPEEPVWPKRPLVVALALVLGLAAGIGAAVARSSFFGGI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNPSEIETHTGLNVYSSIPLSAAQRTLDRNIENKVPGLHVLSHLQPEDPAVESLRSLRTALQFAMLEATNNRLLISGATP
                                                                           SGATP

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVGKTFISVNFAAISAATGKRVLLIDADLRKGRVNQFLSISRAGGLSELIAGTLDFEKAVRPSVLPNLDVITTGVLPPNP
GVGKTFISVNFAAISAATGKRVLLIDADLRKGRVNQFLSISRAGGLSELIAGTLDFEKAVRPSVLPNLDVITTGVLPPNP
  GKT                 LLIDADLR                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELLMSESFVHVLDRLSPSYDLVIVDTAPVLVAADTASVAPLASTLLLVARAEKTQLGELNETVRRLAHAGRSVNGVILN
AELLMSESFVHVLDRLSPSYDLVIVDTAPVLVAADTASVAPLASTLLLVARAEKTQLGELNETVRRLAHAGRSVNGVILN
                      VIVDTAP                                                   
       730       740       750   
....:....|....:....|....:....|...
AIDLSRRHAGSGGYKYGTYKHLQYSYKSNRDST
AIDLSRRHAGSGGYKYGTYKHLQYSYKSNR   
             YKYGTYKHLQYSY       

© 1998-2019