BYKdb

Annotate results for A0A0D0KMD8

A0A0D0KMD8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D0KMD8
DOMAINtad2/184PVVDFEKLVQIATRRWKIFGAACCAGLALGLVYLFAAQQLYTSEVTILMDDGNASVINEL
RTVQDAVDNENSILSQVELLQSDAVIGGAVDRLKLADNDKFLKSDGFLSDAIKTVRKLVD
VKNWFVPDELTGDTATARRRAAINQIVANLDVVRVPRTYVLNVSFTWADPVLAAQITNEI
GQG
DOMAINcd541/731ISTLPGEGKSTIAANFAELLAKQGSRTVLVDCDLRNPGSTRSLARNARYGLLEVILGKMP
IRQVLVRNSKTNLGFIPAVISQRVLHSSDLLTSAGMSEALSVLAADHDYIILDLPPLGPV
VDARAMARKIDAFVYVAEWGKTSRRVVRHTLETENLIASKCLGVILNKVDEQKLRLYRSF
GSLEFYNSRYQ
SITE-680/-682GKT
SITEWalker A'568/575VLVDCDLR
SITEWalker B650/656IILDLPP
SITEY Cluster726/734YNSRYQKYY
SITEWalker A548/550GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPVVDFEKLVQIATRRWKIFGAACCAGLALGLVYLFAAQQLYTSEVTILMDDGNASVINELRTVQDAVDNENSILSQVEL
 PVVDFEKLVQIATRRWKIFGAACCAGLALGLVYLFAAQQLYTSEVTILMDDGNASVINELRTVQDAVDNENSILSQVEL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQSDAVIGGAVDRLKLADNDKFLKSDGFLSDAIKTVRKLVDVKNWFVPDELTGDTATARRRAAINQIVANLDVVRVPRTY
LQSDAVIGGAVDRLKLADNDKFLKSDGFLSDAIKTVRKLVDVKNWFVPDELTGDTATARRRAAINQIVANLDVVRVPRTY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLNVSFTWADPVLAAQITNEIGQGYLLDKLNSNFETTERASSWLNSRIAELREQSRASDTAVQKFRSDNNLLSAGSVLVS
VLNVSFTWADPVLAAQITNEIGQG                                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQQLDELTRALVVAQDAAAKAEARYSRIMEVLDKGNVNAVVADSLDSNISNDLQKKYLEASKRESEISNRLGPDHIQAIR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRAEMEQYKLQMFGELRRISNSYRNELEVAKAQERITTENLNKAKVVTAVAGEKQVELRQLERTAETDSNLLKLFLERYQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QALQQQSFPVTDARIIAKAKVSDVPSHPRKPLLLALFVMAGAAIGLCLAALKEFRDRYFRTGEQVTAELGLQFLGAAPLL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPAKGEKAPVNTSANEIEKVSSVTNYVVEHPLSGFAETLRRAKIAADLAIPGDGCKTIGIISTLPGEGKSTIAANFAELL
                                                            ISTLPGEGKSTIAANFAELL
                                                                   GKS          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKQGSRTVLVDCDLRNPGSTRSLARNARYGLLEVILGKMPIRQVLVRNSKTNLGFIPAVISQRVLHSSDLLTSAGMSEAL
AKQGSRTVLVDCDLRNPGSTRSLARNARYGLLEVILGKMPIRQVLVRNSKTNLGFIPAVISQRVLHSSDLLTSAGMSEAL
       VLVDCDLR                                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVLAADHDYIILDLPPLGPVVDARAMARKIDAFVYVAEWGKTSRRVVRHTLETENLIASKCLGVILNKVDEQKLRLYRSF
SVLAADHDYIILDLPPLGPVVDARAMARKIDAFVYVAEWGKTSRRVVRHTLETENLIASKCLGVILNKVDEQKLRLYRSF
         IILDLPP                                                                
       730        
....:....|....:...
GSLEFYNSRYQKYYIEQA
GSLEFYNSRYQ       
     YNSRYQKYY    

© 1998-2019