BYKdb

Annotate results for A0A0D0KMH9

A0A0D0KMH9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D0KMH9
DOMAINtad1/178MIDLERLFKAVMRQRVIVAAVAALMMVVSGIYAITAVPMFTATSSVMIDKGRSLVLQQLT
DLGGSSDDETTVLSQIEVFRSQAVGYEVVDRLKLVDNAEFMAEDRSIIDVLKSGLAGIFG
SDETEGSPDADQLRDSALSRLQAGMDVERVGQTYIINISYTSPSPELSAKIATGIAEA
DOMAINcd538/728ASTLPDEGKSTVAVNFARLLASQGHQCVLIDADLRSPGATRMIAPHAKAGLVEVLLGEVS
VEDALMTDPLSGMKFMPTVLRERLPFSAELLVSPAMRGVFANLLSKYEYIVLDLPPVGAV
VDARALSSTIDSFVYVVEWGRTARRAVRNAFQTEEQISRKCAGVILSKVDQKKMRLYSLH
GDTEYYASRYS
SITEWalker A545/547GKS
SITEWalker A'565/572VLIDADLR
SITEWalker B647/653IVLDLPP
SITE-644/-646YEY
SITEY Cluster722/731YYASRYSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIDLERLFKAVMRQRVIVAAVAALMMVVSGIYAITAVPMFTATSSVMIDKGRSLVLQQLTDLGGSSDDETTVLSQIEVFR
MIDLERLFKAVMRQRVIVAAVAALMMVVSGIYAITAVPMFTATSSVMIDKGRSLVLQQLTDLGGSSDDETTVLSQIEVFR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQAVGYEVVDRLKLVDNAEFMAEDRSIIDVLKSGLAGIFGSDETEGSPDADQLRDSALSRLQAGMDVERVGQTYIINISY
SQAVGYEVVDRLKLVDNAEFMAEDRSIIDVLKSGLAGIFGSDETEGSPDADQLRDSALSRLQAGMDVERVGQTYIINISY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSPSPELSAKIATGIAEAYLRDSLNSKYEATRRASKWLQERIAELEQKALQSDLAVERFRASNGLLSTGNGLVTDQNLAQ
TSPSPELSAKIATGIAEA                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INSALGTAQSQAATARARYEEITKNIEANDVDAVVKEVLDSPIANNLREQYLLSAKSEAEISARLGPNHEQAVRHRRNMA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYKALLFGELGRIAQSYNNEAQVADGRVRSLLASLATSSSQSAVADQSQVKLRELQREAETYRNLYQSFLQRYQQAIQQQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFSATGARIISRAAPPLIPSSPKLMLSIVGGLLLGGILGGAIGALREFQERFYRTGDGIREDLGKEFLGMLPLVDDRDNT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALPVVSEQATERSVRAGSLTSRYSLSNPLSSFAETLRSAKIAVDFSTSPNANRIVGIASTLPDEGKSTVAVNFARLLASQ
                                                         ASTLPDEGKSTVAVNFARLLASQ
                                                                GKS             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GHQCVLIDADLRSPGATRMIAPHAKAGLVEVLLGEVSVEDALMTDPLSGMKFMPTVLRERLPFSAELLVSPAMRGVFANL
GHQCVLIDADLRSPGATRMIAPHAKAGLVEVLLGEVSVEDALMTDPLSGMKFMPTVLRERLPFSAELLVSPAMRGVFANL
    VLIDADLR                                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSKYEYIVLDLPPVGAVVDARALSSTIDSFVYVVEWGRTARRAVRNAFQTEEQISRKCAGVILSKVDQKKMRLYSLHGDT
LSKYEYIVLDLPPVGAVVDARALSSTIDSFVYVVEWGRTARRAVRNAFQTEEQISRKCAGVILSKVDQKKMRLYSLHGDT
      IVLDLPP                                                                   
       730     
....:....|....:
EYYASRYSSYYEEAS
EYYASRYS       
 YYASRYSSYY    

© 1998-2019