BYKdb

Annotate results for A0A0D0SIP0

A0A0D0SIP0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D0SIP0
DOMAINcd50/234TSEKASSGKSTISANIAITYAQAGYRTLIIDGDMRRATQHYVFNLTNNSGLSNLIIGKTL
EIDAIKETHIENLDVLTSGPVPPNPSELITTRKFRELYQKLATEYDFIIIDTPPVNTVTD
AQLYAQIVRDCILVIDSEKSDKNEVKKAKELIEQSNGKVIGAVLNKAAKDNSSSYYNYYG
DGNDD
SITE-106/-108GKT
SITEWalker A'77/84LIIDGDMR
SITEWalker B157/163IIIDTPP
SITE-69/-74YAQAGY
SITEY Cluster224/228YYNYY
SITEWalker A57/59GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKNKGASKISPLFTYDKPKSIISEKFRGIRSNIMFSNADKEISSILITSEKASSGKSTISANIAITYAQAGYRTLIID
                                                 TSEKASSGKSTISANIAITYAQAGYRTLIID
                                                        GKS                 LIID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDMRRATQHYVFNLTNNSGLSNLIIGKTLEIDAIKETHIENLDVLTSGPVPPNPSELITTRKFRELYQKLATEYDFIIID
GDMRRATQHYVFNLTNNSGLSNLIIGKTLEIDAIKETHIENLDVLTSGPVPPNPSELITTRKFRELYQKLATEYDFIIID
GDMR                                                                        IIID
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
TPPVNTVTDAQLYAQIVRDCILVIDSEKSDKNEVKKAKELIEQSNGKVIGAVLNKAAKDNSSSYYNYYGDGNDD
TPPVNTVTDAQLYAQIVRDCILVIDSEKSDKNEVKKAKELIEQSNGKVIGAVLNKAAKDNSSSYYNYYGDGNDD
TPP                                                            YYNYY      
© 1998-2019