BYKdb

Annotate results for A0A0D1A945

A0A0D1A945 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D1A945
DOMAINcd57/240TSSDVSEGKSTISANTAVTWAQQGKKVLFVDADLRRPTLHTTFGLNNTQGLSTILTQNLD
FHDHVYDSGVENLSIITSGPVPPNPAELLNSNRMKALVTQMQEEYDLVVLDVPPLLSVTD
TQVLASSADGVILVVRQGAAQQAAVKRSVELLEMVHANLLGYVLNDVAPKNGYGYGYGYG
YGYE
SITEWalker A64/66GKS
SITEWalker A'84/91LFVDADLR
SITEWalker B164/170VVLDVPP
SITEY Cluster229/239YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFRRNKKLSTDTSANGVKLITAMKPKDVISEQFRTIRTNIDFSSVDRQLKTILFTSSDVSEGKSTISANTAVTWAQQG
                                                        TSSDVSEGKSTISANTAVTWAQQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKVLFVDADLRRPTLHTTFGLNNTQGLSTILTQNLDFHDHVYDSGVENLSIITSGPVPPNPAELLNSNRMKALVTQMQEE
KKVLFVDADLRRPTLHTTFGLNNTQGLSTILTQNLDFHDHVYDSGVENLSIITSGPVPPNPAELLNSNRMKALVTQMQEE
   LFVDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDLVVLDVPPLLSVTDTQVLASSADGVILVVRQGAAQQAAVKRSVELLEMVHANLLGYVLNDVAPKNGYGYGYGYGYGYE
YDLVVLDVPPLLSVTDTQVLASSADGVILVVRQGAAQQAAVKRSVELLEMVHANLLGYVLNDVAPKNGYGYGYGYGYGYE
   VVLDVPP                                                          YGYGYGYGYGY 
© 1998-2019