BYKdb

Annotate results for A0A0D1C095

A0A0D1C095 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D1C095
DOMAINtad13/149AGLDLADYLRVVRVYWKAIVAFTLLATLTAFGWTVLQPKIYSSDSSGIVVTPGSDNVSLS
LAGDSLAKAKVKNYESVAKSRLVADRVIASLELKTTADALLGTISVKVPLDTAEIRVTAQ
SPDPATAQRVADAWVNG
DOMAINcd306/492TSSLQAEGKSTVTANLAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAE
LEDVLQPWGALPNLSVLGSGRVPPNPSELLGSRAMKNMLNALAENAIVLIDAPPLLPVTD
AAVLSRVADGAIVVIRTGRTTQEQLAQSLGNLEKVKGRILGAVLNYVPTKGTDAHSYYGT
YASAPET
SITEWalker A313/315GKS
SITEWalker A'333/340VVVDGDLR
SITEWalker B413/419VLIDAPP
SITEY Cluster482/486YYGTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVNIAPGAEAPAGLDLADYLRVVRVYWKAIVAFTLLATLTAFGWTVLQPKIYSSDSSGIVVTPGSDNVSLSLAGDSLAK
            AGLDLADYLRVVRVYWKAIVAFTLLATLTAFGWTVLQPKIYSSDSSGIVVTPGSDNVSLSLAGDSLAK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKVKNYESVAKSRLVADRVIASLELKTTADALLGTISVKVPLDTAEIRVTAQSPDPATAQRVADAWVNGLAAQVEAIETA
AKVKNYESVAKSRLVADRVIASLELKTTADALLGTISVKVPLDTAEIRVTAQSPDPATAQRVADAWVNG           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPETAAPDAGTSPDAATAPAATASAVRILPLGKAVLPTSPVSPNVNLALSLGALTGLALGAAYALVRRHLDRRIRNAAEV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERLFEVPVIGTLPVDHRLDEKSTILDAGTAAQLDDAGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSLQAEGKSTVTAN
                                                                 TSSLQAEGKSTVTAN
                                                                        GKS     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELEDVLQPWGALPNLSVLGSGRVPPNPSELLGSRAM
LAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELEDVLQPWGALPNLSVLGSGRVPPNPSELLGSRAM
            VVVDGDLR                                                            
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNMLNALAENAIVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGRTTQEQLAQSLGNLEKVKGRILGAVLNYVPTKGTDAH
KNMLNALAENAIVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGRTTQEQLAQSLGNLEKVKGRILGAVLNYVPTKGTDAH
            VLIDAPP                                                             
       490       500       510       520         
....:....|....:....|....:....|....:....|....:....
SYYGTYASAPETTDVPDFAQPDASVQAGRRDTEAEEVLEPLSAGRRVRN
SYYGTYASAPET                                     
 YYGTY                                           
© 1998-2019