BYKdb

Annotate results for A0A0D1EKM5

A0A0D1EKM5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D1EKM5
DOMAINtad55/239DTVDLRRLLIALWRRKWLIVGATVIGMLIAYAIVSRLTPQYTARASVMLDPRTVQVVTSD
EIISDLTLNNSVVDTELAVLRSNLLLEQVIASFGPGELDPIDPANDPPGLLSRLRGAIGL
GGSGGGAEGASAPITQEERRMRRLLVSMRRKVTVWREGQSYLLSIGVTTTDAVLSKEIAN
RIAET
DOMAINcd580/768TSSVPGEGKTTTAVGLATVEGLAHRRCVLLDFDLRRSNLGRELEYDPQGGGDLTALLRGE
CNVEAAVHRVDPFGFDLITTRGRNPQLIDDTSVERLREVIKDLESRYEMVIVDTPPVLLV
ADTLTLVGLIDTVLMVVKQTTTRRNAVQDTLRTVEDAGARSIGLVMSMVDSRDEQETYGT
SGDYSYANR
SITEWalker A587/589GKT
SITEWalker A'607/614VLLDFDLR
SITEWalker B689/695VIVDTPP
SITEY Cluster757/765YGTSGDYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSAGVGNVRGTSDPGKPGGVRISRFLGRPIVNSNADNLTVPQFGPPMRPAPTQDTVDLRRLLIALWRRKWLIVGATVIG
                                                      DTVDLRRLLIALWRRKWLIVGATVIG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIAYAIVSRLTPQYTARASVMLDPRTVQVVTSDEIISDLTLNNSVVDTELAVLRSNLLLEQVIASFGPGELDPIDPAND
MLIAYAIVSRLTPQYTARASVMLDPRTVQVVTSDEIISDLTLNNSVVDTELAVLRSNLLLEQVIASFGPGELDPIDPAND

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPGLLSRLRGAIGLGGSGGGAEGASAPITQEERRMRRLLVSMRRKVTVWREGQSYLLSIGVTTTDAVLSKEIANRIAETY
PPGLLSRLRGAIGLGGSGGGAEGASAPITQEERRMRRLLVSMRRKVTVWREGQSYLLSIGVTTTDAVLSKEIANRIAET 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISSQIEQRSATIRSASSFLTERVEEIRASVEAAEAAVEEFRRSQLETAGVSAETLEQQLLELSSQVSVAKADLASVKSRF


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRIQTLIDAEGIEAASELLSSPLVVALREQLLALRREDADLATRLGPEHPQRQRLQAQIDAIVEDLAAEVRKIVAGLRND


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEVAQIRSESLESSLSEIEERAGAMSRSSLELRQLEREAEAIRSIYQMMLERLNETRSVEQLQRADARMVNTAQVPGAPS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APRTTLFSVLGGTVGFMIGVIAALAGAISTRGFNRASEIERSFGITVLTSLPLGAWRSLRGMQKSIQKLPYQPFADRLRI


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRENIRPRHISGTQRTVLITSSVPGEGKTTTAVGLATVEGLAHRRCVLLDFDLRRSNLGRELEYDPQGGGDLTALLRGEC
                   TSSVPGEGKTTTAVGLATVEGLAHRRCVLLDFDLRRSNLGRELEYDPQGGGDLTALLRGEC
                          GKT                 VLLDFDLR                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVEAAVHRVDPFGFDLITTRGRNPQLIDDTSVERLREVIKDLESRYEMVIVDTPPVLLVADTLTLVGLIDTVLMVVKQTT
NVEAAVHRVDPFGFDLITTRGRNPQLIDDTSVERLREVIKDLESRYEMVIVDTPPVLLVADTLTLVGLIDTVLMVVKQTT
                                                VIVDTPP                         
       730       740       750       760        
....:....|....:....|....:....|....:....|....:...
TRRNAVQDTLRTVEDAGARSIGLVMSMVDSRDEQETYGTSGDYSYANR
TRRNAVQDTLRTVEDAGARSIGLVMSMVDSRDEQETYGTSGDYSYANR
                                    YGTSGDYSY   

© 1998-2019