BYKdb

Annotate results for A0A0D1J4Z4

A0A0D1J4Z4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D1J4Z4
DOMAINtad1/121MTISAVIVLALLASIAITVTTTPLYKSSTRLFVSTYAGSSLMDTYQGNLLSQERVRSYTI
LLTGEALAQRTIDALHLDMSARALRQEVSARSKMGTVLIDVDVLDPSPVRARDIANTLSD
Q
DOMAINcd253/440TSSIPNEGKSTTAVNIALALVEVEYNVLLVDGDMRRSIAHKHLNVDGAVGLSTVLSGAVS
LSDALQETQFSGLTVLAAGATPPNPSELLASHAAKNLLEELRGKFDYVIVDSCPLLAVTD
AALLAANADGALLLGRYGQTKRDQLKNATDALQNVGAPLLGSVFVMTPPRSRSAYGGAYY
YYGDKRGS
SITEWalker A260/262GKS
SITEWalker A'280/287LLVDGDMR
SITEWalker B360/366VIVDSCP
SITEY Cluster427/434YGGAYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTISAVIVLALLASIAITVTTTPLYKSSTRLFVSTYAGSSLMDTYQGNLLSQERVRSYTILLTGEALAQRTIDALHLDMS
MTISAVIVLALLASIAITVTTTPLYKSSTRLFVSTYAGSSLMDTYQGNLLSQERVRSYTILLTGEALAQRTIDALHLDMS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARALRQEVSARSKMGTVLIDVDVLDPSPVRARDIANTLSDQFVKMVRELETPGDGSLPDTRVVVEQPAAIASSPAVPNLM
ARALRQEVSARSKMGTVLIDVDVLDPSPVRARDIANTLSDQ                                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNLALGLFAGVLLGVACALGREVIDNTVKKHEDLESITGVAVVGDIPMDKARRGTPAISFGTENSQIAESFRKLRTNLSF


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSVDNPPRVIVVTSSIPNEGKSTTAVNIALALVEVEYNVLLVDGDMRRSIAHKHLNVDGAVGLSTVLSGAVSLSDALQET
            TSSIPNEGKSTTAVNIALALVEVEYNVLLVDGDMRRSIAHKHLNVDGAVGLSTVLSGAVSLSDALQET
                   GKS                 LLVDGDMR                                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFSGLTVLAAGATPPNPSELLASHAAKNLLEELRGKFDYVIVDSCPLLAVTDAALLAANADGALLLGRYGQTKRDQLKNA
QFSGLTVLAAGATPPNPSELLASHAAKNLLEELRGKFDYVIVDSCPLLAVTDAALLAANADGALLLGRYGQTKRDQLKNA
                                       VIVDSCP                                  
       410       420       430       440        
....:....|....:....|....:....|....:....|....:...
TDALQNVGAPLLGSVFVMTPPRSRSAYGGAYYYYGDKRGSNSRHSQKT
TDALQNVGAPLLGSVFVMTPPRSRSAYGGAYYYYGDKRGS        
                          YGGAYYYY              
© 1998-2019