BYKdb

Annotate results for A0A0D1KC27

A0A0D1KC27 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D1KC27
DOMAINcd34/221TSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHTAFFLENTVGLTSVLLKKSS
MEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVAD
AQILGNVADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGN
KDNFMQNK
SITE-171/-173GKT
SITEWalker A'61/68LLIDADLR
SITEWalker B141/147VIFDTPP
SITE-132/-138YEACAAY
SITEY Cluster208/211YGYY
SITEWalker A41/43GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHTAFFLEN
                                 TSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHTAFFLEN
                                        GKS                 LLIDADLR            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVADAQILGNV
TVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVADAQILGNV
                                                            VIFDTPP             
       170       180       190       200       210       220 
....:....|....:....|....:....|....:....|....:....|....:....|.
ADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
ADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
                                               YGYY          
© 1998-2019