BYKdb

Annotate results for A0A0D1RD30

A0A0D1RD30 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D1RD30
DOMAINcd50/229ASPTSEAGKTTTAANIAVVFAQQGKKVLIVDTDLRRPVLHELFQVDNKFGLTSTLTGAQI
LEDCIKRTEVNGLYLLPCGPIPPNPAELLGSETMKETILHLHKIYDFIIFDTPPILSVSD
AQILANQCDSSLLIIRCGVTEKADALKAKHILGNAPGKLLGVVLNDKEQEKGEAYYYSQN
SITEWalker A57/59GKT
SITEWalker A'77/84LIVDTDLR
SITEWalker B157/163IIFDTPP
SITEY Cluster224/226YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVLKKNKVRQHRQLITHAQSNSVIAEQYRTIRTNIEFAAVDKPIQSLLIASPTSEAGKTTTAANIAVVFAQQGKKVLIVD
                                                 ASPTSEAGKTTTAANIAVVFAQQGKKVLIVD
                                                        GKT                 LIVD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDLRRPVLHELFQVDNKFGLTSTLTGAQILEDCIKRTEVNGLYLLPCGPIPPNPAELLGSETMKETILHLHKIYDFIIFD
TDLRRPVLHELFQVDNKFGLTSTLTGAQILEDCIKRTEVNGLYLLPCGPIPPNPAELLGSETMKETILHLHKIYDFIIFD
TDLR                                                                        IIFD
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
TPPILSVSDAQILANQCDSSLLIIRCGVTEKADALKAKHILGNAPGKLLGVVLNDKEQEKGEAYYYSQN
TPPILSVSDAQILANQCDSSLLIIRCGVTEKADALKAKHILGNAPGKLLGVVLNDKEQEKGEAYYYSQN
TPP                                                            YYY   
© 1998-2019