BYKdb

Annotate results for A0A0D2VRF0

A0A0D2VRF0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D2VRF0
DOMAINtad24/225DEIDLGAIVAAIKRRRGTILGLAVLCTSIGIGASYAVKPSYWAEAVVSLNVRNAVVTDNQ
SVVGDLKVDSSVIRGEIDIITSRVAAGRVVDALALKPEPAVEDGALKTGLQRLGNQIVES
GLFDSVAGLIGPNDTVASLRQTLAATPAPVVPMVSDPREQMINTLLGNVSASNDGRSYSI
RIGYSAASSDQAALIANGFAKE
DOMAINcd567/759TSSVAGEGKSTFCASLTRQLALGHQKVLLIDGDLRRSHLLEVLPANSSLNKGVAPADLIE
VLEGKRDFGDAIRVDEATGLHYLATARHEDNPQRLLMGREMQNVITQALRHYDLIVIDAP
PVMAVSDALVLARYADASLLMVRWNKTSRKLVQDAIKRLRVSGVKVSGAVMTMVDQKKKA
RGGYEDYSYRNPY
SITEWalker A574/576GKS
SITEWalker A'594/601LLIDGDLR
SITEWalker B681/687IVIDAPP
SITEY Cluster750/760YEDYSYRNPYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVEMLSSPISEPAPAQPRPAKGDEIDLGAIVAAIKRRRGTILGLAVLCTSIGIGASYAVKPSYWAEAVVSLNVRNAVVT
                       DEIDLGAIVAAIKRRRGTILGLAVLCTSIGIGASYAVKPSYWAEAVVSLNVRNAVVT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNQSVVGDLKVDSSVIRGEIDIITSRVAAGRVVDALALKPEPAVEDGALKTGLQRLGNQIVESGLFDSVAGLIGPNDTVA
DNQSVVGDLKVDSSVIRGEIDIITSRVAAGRVVDALALKPEPAVEDGALKTGLQRLGNQIVESGLFDSVAGLIGPNDTVA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLRQTLAATPAPVVPMVSDPREQMINTLLGNVSASNDGRSYSIRIGYSAASSDQAALIANGFAKEYLDMQRDEKVRETLN
SLRQTLAATPAPVVPMVSDPREQMINTLLGNVSASNDGRSYSIRIGYSAASSDQAALIANGFAKE               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANDWLKRQVQTLREDVLTAESRVQKLQENAGLGDATRGGSAVNQQMTQLNVQLVAARAATTQAEAKLRSAQDLLRGGSVE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAAGVLASPMLQLLARDQTEIKRKLADMSSQYGDRHPTIIGMRSELGSVEARIKDEIQRAVQTLNTDVAVARASEQSLQS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RMRQLESNYADGAKVEIQVRQFQREADAARELYQNFLQRMKETGAQAELARPDARIISEAVESPFPAFPNRKLFAVIGLV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGLFLGLFIAFVAENLQRGFNDLDEVEGETGIAGFGTIPLVRGRRKNNPVDYLIEKPISSYSEALRTVQSLIHSVSHSRT


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARVILVTSSVAGEGKSTFCASLTRQLALGHQKVLLIDGDLRRSHLLEVLPANSSLNKGVAPADLIEVLEGKRDFGDAIRV
      TSSVAGEGKSTFCASLTRQLALGHQKVLLIDGDLRRSHLLEVLPANSSLNKGVAPADLIEVLEGKRDFGDAIRV
             GKS                 LLIDGDLR                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEATGLHYLATARHEDNPQRLLMGREMQNVITQALRHYDLIVIDAPPVMAVSDALVLARYADASLLMVRWNKTSRKLVQD
DEATGLHYLATARHEDNPQRLLMGREMQNVITQALRHYDLIVIDAPPVMAVSDALVLARYADASLLMVRWNKTSRKLVQD
                                        IVIDAPP                                 
       730       740       750       760  
....:....|....:....|....:....|....:....|..
AIKRLRVSGVKVSGAVMTMVDQKKKARGGYEDYSYRNPYYTD
AIKRLRVSGVKVSGAVMTMVDQKKKARGGYEDYSYRNPY   
                             YEDYSYRNPYY  

© 1998-2019