BYKdb

Annotate results for A0A0D2WNA4

A0A0D2WNA4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D2WNA4
DOMAINtad29/222PTLGLADLLMVLSRRKYLLLGTIGIVTLIGIVNVYMLTPLFTATTSVMVDPREQRVINIE
SLVAGGPADQSTIESEIQVVQSDELASRVIAQLGLDRLAEFNPKVAAEQEADSFQLPSLR
DLPPVQWLKSLLSDGEEETPDPAAAEARLRTAIEAKFLSRLNVSSVGRSRVLNISFTSQD
PAIASSVANSIANL
DOMAINcd565/753TSAVPGEGKSALVATLARVTAIAGRRVLIVDCDLRRPNIHRSLSLPNQYGLADFLSGNAT
LPDVMRTDSRTGADVITAGSPTDNPEEIIRNPLFDQMLFNLRPQYDLILLDAPPVLPVSD
TRILAEKASQCVVVVKWRRTPRKLVQLAIRQLTEAGANIAGVALNQVDTSKAARYGSGEV
EYYMGRRGS
SITEWalker A572/574GKS
SITEWalker A'592/599LIVDCDLR
SITEWalker B672/678ILLDAPP
SITEY Cluster746/747YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKLLTPERQETDRHDWTTHEEGPSRTAPTLGLADLLMVLSRRKYLLLGTIGIVTLIGIVNVYMLTPLFTATTSVMVDPR
                            PTLGLADLLMVLSRRKYLLLGTIGIVTLIGIVNVYMLTPLFTATTSVMVDPR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQRVINIESLVAGGPADQSTIESEIQVVQSDELASRVIAQLGLDRLAEFNPKVAAEQEADSFQLPSLRDLPPVQWLKSLL
EQRVINIESLVAGGPADQSTIESEIQVVQSDELASRVIAQLGLDRLAEFNPKVAAEQEADSFQLPSLRDLPPVQWLKSLL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDGEEETPDPAAAEARLRTAIEAKFLSRLNVSSVGRSRVLNISFTSQDPAIASSVANSIANLYITQQLEQKFDARQKANA
SDGEEETPDPAAAEARLRTAIEAKFLSRLNVSSVGRSRVLNISFTSQDPAIASSVANSIANL                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WLTERLTRLREEVETAERAVETARASQGVVQGRDAGLVNEQLSQLNTQLVMARAENSTSVAQLRSVESAVEARGIRAVFD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTDSTLVNGLRAQETTLRQREAELLNNLGPRHPQVVDLKSQISSVSNEINNEANNRLRALRNQAAVTQQRVASLEQSMSR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEQESARVNQSDVQIRALQREADANRALFENFLARSKETQSVDLEQPNAWIVSTANSPLNPSFPQKPLFIAVALILATGL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLTLVFLAEQLERGMQTQEDVERMLHLPSLGMIPLVKRNRLSRMPPQDYALDKPASAYSQAVKSLFTSLIIAHQRKGTGN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVLLTSAVPGEGKSALVATLARVTAIAGRRVLIVDCDLRRPNIHRSLSLPNQYGLADFLSGNATLPDVMRTDSRTGADVI
    TSAVPGEGKSALVATLARVTAIAGRRVLIVDCDLRRPNIHRSLSLPNQYGLADFLSGNATLPDVMRTDSRTGADVI
           GKS                 LIVDCDLR                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAGSPTDNPEEIIRNPLFDQMLFNLRPQYDLILLDAPPVLPVSDTRILAEKASQCVVVVKWRRTPRKLVQLAIRQLTEAG
TAGSPTDNPEEIIRNPLFDQMLFNLRPQYDLILLDAPPVLPVSDTRILAEKASQCVVVVKWRRTPRKLVQLAIRQLTEAG
                               ILLDAPP                                          
       730       740       750       
....:....|....:....|....:....|....:..
ANIAGVALNQVDTSKAARYGSGEVEYYMGRRGSYFKN
ANIAGVALNQVDTSKAARYGSGEVEYYMGRRGS    
                         YY          

© 1998-2019