BYKdb

Annotate results for A0A0D3L8Q3

A0A0D3L8Q3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D3L8Q3
DOMAINtad13/250EQINFKEIILKYLRYWYLFLLGTIICFGLAYLYLRYTTPQYLITTSILIKSDQQSGGLTE
SAVFNDIPGFKSHTNIDNEIRLLKSQSLMHRVFNELDLDVTYYGDGRIKDPELYGNKLPF
RVVTNKLDSLAYGKVIKVHLKGNNSYDIEYNEKISSHKFGQRVNVGFGEFTIVSDSRLIR
NGMTVRVHFNNIQRLASNYSDRLVVEKDKLAWSSALILSLVDPVPEKGKDILNKLIEV
DOMAINcd581/771TSSTSGEGKTFFSINLGASLALSGKRVVVIDFDLRKPSLLHNLGMTNDFGITNYLVTENT
PIKELIKPTKVSNNLYVVGAGPIPPNPAELMLLPKIGGLIDGLRQQFDYVIIDTSPVGQV
ADALSLAPYIDLSLYLVRYQFTEKEQVKIVNDIYRKKKLNHTMIVLNDARKGGGYGYGKG
YGYGYGYGQEK
SITEWalker A588/590GKT
SITEWalker A'608/615VVIDFDLR
SITEWalker B690/696VIIDTSP
SITE-709/-719YIDLSLYLVRY
SITEY Cluster755/767YGYGKGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTDQDNLLLEDSEQINFKEIILKYLRYWYLFLLGTIICFGLAYLYLRYTTPQYLITTSILIKSDQQSGGLTESAVFNDIP
            EQINFKEIILKYLRYWYLFLLGTIICFGLAYLYLRYTTPQYLITTSILIKSDQQSGGLTESAVFNDIP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFKSHTNIDNEIRLLKSQSLMHRVFNELDLDVTYYGDGRIKDPELYGNKLPFRVVTNKLDSLAYGKVIKVHLKGNNSYDI
GFKSHTNIDNEIRLLKSQSLMHRVFNELDLDVTYYGDGRIKDPELYGNKLPFRVVTNKLDSLAYGKVIKVHLKGNNSYDI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYNEKISSHKFGQRVNVGFGEFTIVSDSRLIRNGMTVRVHFNNIQRLASNYSDRLVVEKDKLAWSSALILSLVDPVPEKG
EYNEKISSHKFGQRVNVGFGEFTIVSDSRLIRNGMTVRVHFNNIQRLASNYSDRLVVEKDKLAWSSALILSLVDPVPEKG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KDILNKLIEVYNKEAVEDKNVIAANTIEFINERLQFLTEELTDVEKDVEEYKRERRLTNVGTEAQLYLQGRTGYDQQLSE
KDILNKLIEV                                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YELQLEILNSIEDYLRREGNEVGIVPSTLSITDHTLNRLIERYNELQLERQRLLLTNKPNNPLVMNLSEQLTDLRQNILE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLSNIRQSMEITRNNLQSNYAQFESKIEQVPGMEREIQAISRQQGIKEGLYLYLLQKREESALSLAATVSNSRIIDPASA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSVPVSPESTTFYLYALVFGIGMPFAFLFIRDMLNNKVQEQKDVERATSTPILGEIAHKRTGENLVVTHDSRSPVAELFR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIRANLQFANAGRSNKVMLVTSSTSGEGKTFFSINLGASLALSGKRVVVIDFDLRKPSLLHNLGMTNDFGITNYLVTENT
                    TSSTSGEGKTFFSINLGASLALSGKRVVVIDFDLRKPSLLHNLGMTNDFGITNYLVTENT
                           GKT                 VVIDFDLR                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIKELIKPTKVSNNLYVVGAGPIPPNPAELMLLPKIGGLIDGLRQQFDYVIIDTSPVGQVADALSLAPYIDLSLYLVRYQ
PIKELIKPTKVSNNLYVVGAGPIPPNPAELMLLPKIGGLIDGLRQQFDYVIIDTSPVGQVADALSLAPYIDLSLYLVRYQ
                                                 VIIDTSP                        
       730       740       750       760       770       780  
....:....|....:....|....:....|....:....|....:....|....:....|..
FTEKEQVKIVNDIYRKKKLNHTMIVLNDARKGGGYGYGKGYGYGYGYGQEKRSWFSRFRKKA
FTEKEQVKIVNDIYRKKKLNHTMIVLNDARKGGGYGYGKGYGYGYGYGQEK           
                                  YGYGKGYGYGYGY               

© 1998-2019