BYKdb

Annotate results for A0A0D3LFR6

A0A0D3LFR6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D3LFR6
DOMAINtad24/260QSIDFDKLFSVLKKSLPIIVVIFLVCNMGAYLYIRYTKPLFQSNSELQLTENKPAASFGF
VDSDKATMEGMSSEIELIKSKLFLNKVLSALDLDVSYFTQGKILDDEKYRSAPFKVDYLL
KDERFFNQKIYVNIHDLQEYTLSYFQGENEVSNRYRFGQAVETGSFNLTLTLLEGTTGDA
INSNYYFIINSDQSLIDYLSTNLTVTILNPNAKTIKISLTDYNPYKARVVVDAVSNM
DOMAINcd596/783TSTISGEGKTFIATNLAGIIALSKKRVIVLDLDMRKPKVHLAFEGENASAGLSTILIGRH
SLEESIRKTSIPNLDYIPAGPTPPNPSELVMNGDFDALLLRLKDLYDVIVMDTPPVGLVT
DGILIMKKADLPLYVFKANYSRKLYFKTLNRLATVNQFNNLAVILNGVSRNKGYGYGYGY
GYGDTGGY
SITEWalker A603/605GKT
SITEWalker A'623/630IVLDLDMR
SITEWalker B704/710IVMDTPP
SITE-729/-740YVFKANYSRKLY
SITEY Cluster769/784YGYGYGYGYGDTGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKEDTTYVEYTDAPDEQPEGGPLQSIDFDKLFSVLKKSLPIIVVIFLVCNMGAYLYIRYTKPLFQSNSELQLTENKPAAS
                       QSIDFDKLFSVLKKSLPIIVVIFLVCNMGAYLYIRYTKPLFQSNSELQLTENKPAAS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGFVDSDKATMEGMSSEIELIKSKLFLNKVLSALDLDVSYFTQGKILDDEKYRSAPFKVDYLLKDERFFNQKIYVNIHDL
FGFVDSDKATMEGMSSEIELIKSKLFLNKVLSALDLDVSYFTQGKILDDEKYRSAPFKVDYLLKDERFFNQKIYVNIHDL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEYTLSYFQGENEVSNRYRFGQAVETGSFNLTLTLLEGTTGDAINSNYYFIINSDQSLIDYLSTNLTVTILNPNAKTIKI
QEYTLSYFQGENEVSNRYRFGQAVETGSFNLTLTLLEGTTGDAINSNYYFIINSDQSLIDYLSTNLTVTILNPNAKTIKI

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLTDYNPYKARVVVDAVSNMYLTYKEEEQIKANNQKIAFLNTLVEDAESKLEGYETYFEDFTISQRTTNLNKDISNTILL
SLTDYNPYKARVVVDAVSNM                                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LESVDSQRVATRRQLNNLTNLSSRIKSEDTYFAQSLVNRAGDDFPADIKTLLDQLNKLISEKEVLLEHYNENTQAAQMKI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQVSMIKEDLLAALQLYESDLRKQVDDLQFRHRELLSSFVQLPSKGTEFSKSQRDYNQLLEVLLNLQSKKIEFEIANAGS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTDYKILSSASMPGAPISPDKYLFHGIGLAAGLMLSLLFVGGRYMLDNKVNGVAEVERLANVPVLGAVPLTLSKLATARM


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VITDNPKSAFSESMRAIRTNMEFLGARQNNRIISVTSTISGEGKTFIATNLAGIIALSKKRVIVLDLDMRKPKVHLAFEG
                                   TSTISGEGKTFIATNLAGIIALSKKRVIVLDLDMRKPKVHLAFEG
                                          GKT                 IVLDLDMR          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENASAGLSTILIGRHSLEESIRKTSIPNLDYIPAGPTPPNPSELVMNGDFDALLLRLKDLYDVIVMDTPPVGLVTDGILI
ENASAGLSTILIGRHSLEESIRKTSIPNLDYIPAGPTPPNPSELVMNGDFDALLLRLKDLYDVIVMDTPPVGLVTDGILI
                                                               IVMDTPP          
       730       740       750       760       770       780      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
MKKADLPLYVFKANYSRKLYFKTLNRLATVNQFNNLAVILNGVSRNKGYGYGYGYGYGDTGGYYEE
MKKADLPLYVFKANYSRKLYFKTLNRLATVNQFNNLAVILNGVSRNKGYGYGYGYGYGDTGGY   
                                                YGYGYGYGYGDTGGYY  

© 1998-2019