BYKdb

Annotate results for A0A0D3VD82

A0A0D3VD82 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D3VD82
DOMAINcd47/228ASAQAGEGKTITVSNLAVAYAQEGKKVLLIDVDFRKPSLHKVFTVSNQTGLTSVLSNQCE
LQDVVRETFVEHLDVITSGPIPPNPSEMLSSRKMKTVLEETKDLYDVILFDTPPVLAVTD
ALIVSSFCDGVILVVNSSKVKKEVVKKAKANLEHVNARFLGVVLNNINVGKDNPYYYYYG
EK
SITEWalker A54/56GKT
SITEWalker A'74/81LLIDVDFR
SITEWalker B154/160ILFDTPP
SITEY Cluster221/225YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRSINENHNLVTSINPKSPISEAYRTLRTNILFSSIDEQIRTIMVASAQAGEGKTITVSNLAVAYAQEGKKVLLIDVDF
                                              ASAQAGEGKTITVSNLAVAYAQEGKKVLLIDVDF
                                                     GKT                 LLIDVDF
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPSLHKVFTVSNQTGLTSVLSNQCELQDVVRETFVEHLDVITSGPIPPNPSEMLSSRKMKTVLEETKDLYDVILFDTPP
RKPSLHKVFTVSNQTGLTSVLSNQCELQDVVRETFVEHLDVITSGPIPPNPSEMLSSRKMKTVLEETKDLYDVILFDTPP
R                                                                        ILFDTPP
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
VLAVTDALIVSSFCDGVILVVNSSKVKKEVVKKAKANLEHVNARFLGVVLNNINVGKDNPYYYYYGEK
VLAVTDALIVSSFCDGVILVVNSSKVKKEVVKKAKANLEHVNARFLGVVLNNINVGKDNPYYYYYGEK
                                                            YYYYY   
© 1998-2019