BYKdb

Annotate results for A0A0D4CMJ0

A0A0D4CMJ0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D4CMJ0
DOMAINcd57/248TSANISEGKSTVAANLAIVWAQEGKSVLLIDADMRRPTLNSTFDLTGQSGLSTVLSSDQS
EVNLNDVIQESGIEGLDLLPSGAVPPNPAELLSSQRMKVLLEAVQAQYDLVVLDVPPMLE
VTDTQTIAGSVDGVVLVVRQGITQKAGVRRAVELLKMSHAHLLGYVMNDVVPEDDAGYGY
GYGYGYGYGYEK
SITE-80/-82GKS
SITEWalker A'84/91LLIDADMR
SITEWalker B167/173VVLDVPP
SITEY Cluster234/246YGYGYGYGYGYGY
SITEWalker A64/66GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGIFKRKSRIDNNTMKNGAKLITVAKPKSVAAEQFRTVRTNIHFMAVDRRLKTIAFTSANISEGKSTVAANLAIVWAQEG
                                                        TSANISEGKSTVAANLAIVWAQEG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSVLLIDADMRRPTLNSTFDLTGQSGLSTVLSSDQSEVNLNDVIQESGIEGLDLLPSGAVPPNPAELLSSQRMKVLLEAV
KSVLLIDADMRRPTLNSTFDLTGQSGLSTVLSSDQSEVNLNDVIQESGIEGLDLLPSGAVPPNPAELLSSQRMKVLLEAV
   LLIDADMR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGITQKAGVRRAVELLKMSHAHLLGYVMNDVVPEDDAGYGYGYGY
QAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGITQKAGVRRAVELLKMSHAHLLGYVMNDVVPEDDAGYGYGYGY
      VVLDVPP                                                            YGYGYGY
       250  
....:....|..
GYGYGYEKESEN
GYGYGYEK    
GYGYGY      
© 1998-2019