BYKdb

Annotate results for A0A0D5BSQ0

A0A0D5BSQ0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D5BSQ0
DOMAINcd586/776TSFSAGVGKTFSALNLATTLSYLEKKVVVIDLDLRKGTLSSRIDLLHGKGVSHYLSSPSV
SVDEVLHKSEVANGVDFVPIGAIAPNPVELLLSKRLDELINELKERYDYVIIDGVPVGIV
ADASIIDRVADLTLFIIRVGKMDRRQLPEIEKIYQEKKLSNLAIVLNGMKLNGYGYGYGY
GSYGYGYGEEK
SITEWalker A593/595GKT
SITEWalker A'613/620VVIDLDLR
SITEWalker B695/701VIIDGVP
SITE-692/-694YDY
SITEY Cluster759/772YGYGYGYGSYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MINQNKQNVQKDGIINVLDILKYFLFHWKWFALSVLIFGGYYYYQYSKTPFVYNRSEVVMIRTPSNTPTTARITRSSSAN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VISVKDEILQLKSKELMRQTIDRIGADISYKIRKGLRDYELYKKSPVQVKVEGKSSEDNYAFTVIPVDMKHVVIKNWSNT


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKNEEFKVVLNQSVVTPIGKVLIKPSKFYKKDYYGTEIQVTKSPRESMTGYFVGNLVVKQMEEDTSLLQITLSDNSSERA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDILTLLVQVYNEVYLQDKNKIAVNTAKFIKDRLVIIEAELGAVESNIENLKVANQGIDVETAGSMYLAEKNQYKTDRTK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VETDIRLAEMMRSYLGSRDQKNALIPNSTGLVDANVETQITEYNTALLKRNRLAEGGNTSNPVVLDLDEALKAMRNNIGR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVDNTLRGLNVRLNNAKQEEATAQSKTLQIPQQERAILSIERQRKIKEELYLFLLNKREENALNEAIAESNLRIVDPPTG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDFPVSPNKLKKLSIGVAIGAVLPAVVLLSMLMLNTGVRGRQDLEDVLSVPFLGEIPLMRSRKQGKSDVLVSKSGRDPLT


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAFRILRTNINFMAKNGEPPRVITFTSFSAGVGKTFSALNLATTLSYLEKKVVVIDLDLRKGTLSSRIDLLHGKGVSHYL
                         TSFSAGVGKTFSALNLATTLSYLEKKVVVIDLDLRKGTLSSRIDLLHGKGVSHYL
                                GKT                 VVIDLDLR                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSPSVSVDEVLHKSEVANGVDFVPIGAIAPNPVELLLSKRLDELINELKERYDYVIIDGVPVGIVADASIIDRVADLTLF
SSPSVSVDEVLHKSEVANGVDFVPIGAIAPNPVELLLSKRLDELINELKERYDYVIIDGVPVGIVADASIIDRVADLTLF
                                                      VIIDGVP                   
       730       740       750       760       770       780       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
IIRVGKMDRRQLPEIEKIYQEKKLSNLAIVLNGMKLNGYGYGYGYGSYGYGYGEEKKKSVFDWFKRS
IIRVGKMDRRQLPEIEKIYQEKKLSNLAIVLNGMKLNGYGYGYGYGSYGYGYGEEK           
                                      YGYGYGYGSYGYGY               

© 1998-2019