BYKdb

Annotate results for A0A0D5N3E9

A0A0D5N3E9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D5N3E9
DOMAINcd95/286TSTFGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAEYLGIPGERGLSEYLRVGA
HLPELLVRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRYRYPDRYVIIDAPPALP
FAEVRSLSNLVDSIVFVVREGQSSLANIDEAIGALNRKKILGIVFNEASAVGISSKYGYG
YGYGGYGQSAES
SITEWalker A102/104GKS
SITEWalker A'123/130LLIDADLR
SITEWalker B205/211VIIDAPP
SITE-198/-204YRYPDRY
SITEY Cluster271/280YGYGYGYGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRIEQALEKAAMLRGTTDRGPAVAPRQMEDVQPLERAELPPLPAEPLEGIRHDNPLLATLNDPHSYVSEEYRKLKSAIV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGTSVGEFRNTIMITSTFGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAEYLGIPGERGLSEYLRVGAHLPELL
              TSTFGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAEYLGIPGERGLSEYLRVGAHLPELL
                     GKS                  LLIDADLR                              
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRYRYPDRYVIIDAPPALPFAEVRSLSNLVDSIVFVVREGQSSLA
VRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRYRYPDRYVIIDAPPALPFAEVRSLSNLVDSIVFVVREGQSSLA
                                            VIIDAPP                             
       250       260       270       280       290       300         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
NIDEAIGALNRKKILGIVFNEASAVGISSKYGYGYGYGGYGQSAESAGARSKAEKTGKLSRILGKRGSK
NIDEAIGALNRKKILGIVFNEASAVGISSKYGYGYGYGGYGQSAES                       
                              YGYGYGYGGY                             
© 1998-2019