BYKdb

Annotate results for A0A0D5NL38

A0A0D5NL38 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D5NL38
DOMAINcd46/228ASAQSGEGKSTTVSNLAVTYAQEGKKVLLIDADLRKPTMHRIFGLSNRVGLTSVITGQIR
PSDAIQSTEVINLSLLPSGTIPPNPAELLASQKMKAFVNEMKGAYDMVIFDTPPVLAVAD
SLIVSSVCDGVVIVVQEGRVKRELVRKAKESLERVNAKLIGVVLNNVKKSKDGYYYYYRE
TAE
SITEWalker A53/55GKS
SITEWalker A'73/80LLIDADLR
SITEWalker B153/159VIFDTPP
SITEY Cluster219/223YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRLISNSNLVTLHTPKSPISEAYRTLRTNIQFSSIDNKINVLMVASAQSGEGKSTTVSNLAVTYAQEGKKVLLIDADLR
                                             ASAQSGEGKSTTVSNLAVTYAQEGKKVLLIDADLR
                                                    GKS                 LLIDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPTMHRIFGLSNRVGLTSVITGQIRPSDAIQSTEVINLSLLPSGTIPPNPAELLASQKMKAFVNEMKGAYDMVIFDTPPV
KPTMHRIFGLSNRVGLTSVITGQIRPSDAIQSTEVINLSLLPSGTIPPNPAELLASQKMKAFVNEMKGAYDMVIFDTPPV
                                                                        VIFDTPP 
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
LAVADSLIVSSVCDGVVIVVQEGRVKRELVRKAKESLERVNAKLIGVVLNNVKKSKDGYYYYYRETAE
LAVADSLIVSSVCDGVVIVVQEGRVKRELVRKAKESLERVNAKLIGVVLNNVKKSKDGYYYYYRETAE
                                                          YYYYY     
© 1998-2019