BYKdb

Annotate results for A0A0D6DUY5

A0A0D6DUY5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D6DUY5
DOMAINcd50/230ASSEAAAGKSTTIANLAVVFAQQGKKVLLIDADVRKPSVHLTFKLQNRIGLTNVLTRLIS
VNDAIQGTRISENLSIISSGPIPPNPSELLSSSAMQNLIDSASKNFDIVLIDTAPLSAVT
DAQILSRYVGGAVIVAHANQTKKESLSKTKKLLEQVNANILGVVLHGIELSDTAYYYYGT
E
SITEWalker A57/59GKS
SITEWalker A'77/84LLIDADVR
SITEWalker B158/164VLIDTAP
SITEY Cluster224/227YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKKEKKINGNRYLITSLNPKSPISEQYRTIRTTIDFKMLDQGLKSFLVASSEAAAGKSTTIANLAVVFAQQGKKVLLID
                                                 ASSEAAAGKSTTIANLAVVFAQQGKKVLLID
                                                        GKS                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADVRKPSVHLTFKLQNRIGLTNVLTRLISVNDAIQGTRISENLSIISSGPIPPNPSELLSSSAMQNLIDSASKNFDIVLI
ADVRKPSVHLTFKLQNRIGLTNVLTRLISVNDAIQGTRISENLSIISSGPIPPNPSELLSSSAMQNLIDSASKNFDIVLI
ADVR                                                                         VLI
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTAPLSAVTDAQILSRYVGGAVIVAHANQTKKESLSKTKKLLEQVNANILGVVLHGIELSDTAYYYYGTE
DTAPLSAVTDAQILSRYVGGAVIVAHANQTKKESLSKTKKLLEQVNANILGVVLHGIELSDTAYYYYGTE
DTAP                                                           YYYY   
© 1998-2019