BYKdb

Annotate results for A0A0D6J4Y4

A0A0D6J4Y4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D6J4Y4
DOMAINcd41/221TSVNPGEGKTTTSVNIAMSFARAGYKTLLFDGDIRNSVMSGFFKSREKITGLTEFLSGTA
DLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILITATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGR
K
SITEWalker A48/50GKT
SITEWalker A'68/75LLFDGDIR
SITEWalker B149/155IIVDTPP
SITE-145/-148YFDY
SITEY Cluster215/218YGVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPTLEIAQKKLEFIKKAEEYYNTLCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIAMSFARAGYKTLLFDGDIRNSVMS
                                        TSVNPGEGKTTTSVNIAMSFARAGYKTLLFDGDIRNSVMS
                                               GKT                 LLFDGDIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
                                                                    IIVDTPP     
       170       180       190       200       210       220 
....:....|....:....|....:....|....:....|....:....|....:....|.
DAAIITQKCDASILITATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGRK
DAAIITQKCDASILITATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGRK
                                                      YGVY   
© 1998-2019