BYKdb

Annotate results for A0A0D6KL48

A0A0D6KL48 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D6KL48
DOMAINcd284/470SSSIPGEGKSFVAANLAVAVAQLGRRVLLVDADMRRPRQHKIWEQNNLVGLSNILVGQTE
LQTTSKEALMTLDIITAGTIPPNPAALLNSQRIATFIKEATQEYDFVIIDCPPLTLVADA
LMLSKLVDGILLVVRPGVANTGSVNATKMLLEQSGHQVLGMVANGVTPESSYGGYYAKSY
YGAKQSH
SITEWalker A291/293GKS
SITEWalker A'311/318LLVDADMR
SITEWalker B390/396VIIDCPP
SITEY Cluster455/464YGGYYAKSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKLNTDTAVELTTLSQSPGVQQVLTEYQKVQDELAVARTRLTEDNPKIINLENQAVALKNQLEGRVAQTIGNSEYMPEQN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQIGNLKQTLTENLVKSEVERLALTNQVAELKQVLLVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVE


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQNVGNARVISEALVADKSVSPIIPLNLALGGILGIILGAGTALVLESIDNSLKTVEEAKRLLDYPLLGAIPQAEKAKGS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGVGEVELPVLNNPYSPVSSAFEMLQTNLSFSISDKMLKVIAISSSIPGEGKSFVAANLAVAVAQLGRRVLLVDADMRRP
                                           SSSIPGEGKSFVAANLAVAVAQLGRRVLLVDADMRRP
                                                  GKS                 LLVDADMR  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQHKIWEQNNLVGLSNILVGQTELQTTSKEALMTLDIITAGTIPPNPAALLNSQRIATFIKEATQEYDFVIIDCPPLTLV
RQHKIWEQNNLVGLSNILVGQTELQTTSKEALMTLDIITAGTIPPNPAALLNSQRIATFIKEATQEYDFVIIDCPPLTLV
                                                                     VIIDCPP    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADALMLSKLVDGILLVVRPGVANTGSVNATKMLLEQSGHQVLGMVANGVTPESSYGGYYAKSYYGAKQSHKNGKVDASIS
ADALMLSKLVDGILLVVRPGVANTGSVNATKMLLEQSGHQVLGMVANGVTPESSYGGYYAKSYYGAKQSH          
                                                      YGGYYAKSYY                
     
....:
KIRIL


© 1998-2019