BYKdb

Annotate results for A0A0D6KV51

A0A0D6KV51 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D6KV51
DOMAINtad1/144MVKRQWIPAASIFASTVALSVVATTLLKPSYEAEGKLLFKTPTFNVVGSELLPSESQARG
DLRPLVSTQNPITTQIEVITSPLLLQKTIDELQLKNKEGKPLTPEVLKKALNIKIIGGTD
VLLVSYQSPNPQEAAAVVNNVMNL
DOMAINcd520/707SSAVPKEGKSTVSANLAAAIAQLGRKVLLIDADMRVPTQHHLWQITNTAGLSEVLVGEAE
FKTAASNVIENLDVLTAGVRPPNPLALLDSKRMATLIQEFSNQYDFVIIDAPPLLLAADA
VTLSHMTDGILLVARPGVIDSNSANNAKELLQRSGQNVLGLLVNGINEKNESSNDFYHAK
EYFSADTV
SITEWalker A527/529GKS
SITEWalker A'547/554LLIDADMR
SITEWalker B626/632VIIDAPP
SITEY Cluster696/701YHAKEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVKRQWIPAASIFASTVALSVVATTLLKPSYEAEGKLLFKTPTFNVVGSELLPSESQARGDLRPLVSTQNPITTQIEVIT
MVKRQWIPAASIFASTVALSVVATTLLKPSYEAEGKLLFKTPTFNVVGSELLPSESQARGDLRPLVSTQNPITTQIEVIT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPLLLQKTIDELQLKNKEGKPLTPEVLKKALNIKIIGGTDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEAT
SPLLLQKTIDELQLKNKEGKPLTPEVLKKALNIKIIGGTDVLLVSYQSPNPQEAAAVVNNVMNL                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKFMAKQLPNNRSAVQDAEAALRIFKQKYNIVDLAEETRSAVAIIGNLDSNINGVKADFDQATAQTNELRQKVNLNSQEA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSASAVSQSPAVQGILTQLQDIDRQLASERSRFLDDNPVIINLEQRKTNLQALLKQEIGQTGAGPVNYPPKTLQIGETKQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENNNTPNAR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIAKGSVPIKPTLGLKPFILVLGVLLGAFLATTAVIFLETRDRSLKTLKEIREIFGYTLLGIVPSSTKKIRSRYRETEIA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQEIAVIDSPSSLTSEIYRMIQANLRFLSSDKVLKTIVVSSAVPKEGKSTVSANLAAAIAQLGRKVLLIDADMRVPTQHH
                                       SSAVPKEGKSTVSANLAAAIAQLGRKVLLIDADMRVPTQHH
                                              GKS                 LLIDADMR      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LWQITNTAGLSEVLVGEAEFKTAASNVIENLDVLTAGVRPPNPLALLDSKRMATLIQEFSNQYDFVIIDAPPLLLAADAV
LWQITNTAGLSEVLVGEAEFKTAASNVIENLDVLTAGVRPPNPLALLDSKRMATLIQEFSNQYDFVIIDAPPLLLAADAV
                                                                 VIIDAPP        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLSHMTDGILLVARPGVIDSNSANNAKELLQRSGQNVLGLLVNGINEKNESSNDFYHAKEYFSADTVTTESGAGVRTWSQ
TLSHMTDGILLVARPGVIDSNSANNAKELLQRSGQNVLGLLVNGINEKNESSNDFYHAKEYFSADTV             
                                                       YHAKEY                   
 
.
R


© 1998-2019