BYKdb

Annotate results for A0A0D6MUV2

A0A0D6MUV2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D6MUV2
DOMAINtad20/200SHVSPLKIFEIIRERWLTILLVAGFLVVPAIALILTLPAYYDATSSLMIGTRQAEFRDLQ
ATQGALDVDAVAINTEVGIFKSQSIAKAVAERLKLVDDPYFRAQMEKKSFKTRITGWISK
VTGHADPEKPLTPDEKLQVVRDLLGRNVTILNDGRSYLITVSVRTGRPDLSANIANAFSD
V
DOMAINcd543/730TSSGPEEGKTVFALSLAANTGRAGKKALILDCDTRGPSALEIVQASGKGKGERHLVTSLD
KRGLSRDVLPGVDVMTMNNWKSPSDQMIVPEVLQVVLAELSPHYDLIILDTPPLLAFPDA
AVLSHETDGVVLVVKWGVTTQENLKGAMRQLEAYDARTLGAVLTQVPAGSASGLSGAALQ
VYRHYGLL
SITEWalker A550/552GKT
SITEWalker A'570/577LILDCDTR
SITEWalker B649/655IILDTPP
SITEY Cluster724/727YRHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVVQSNLLDRISEPPPDASHVSPLKIFEIIRERWLTILLVAGFLVVPAIALILTLPAYYDATSSLMIGTRQAEFRDLQA
                   SHVSPLKIFEIIRERWLTILLVAGFLVVPAIALILTLPAYYDATSSLMIGTRQAEFRDLQA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQGALDVDAVAINTEVGIFKSQSIAKAVAERLKLVDDPYFRAQMEKKSFKTRITGWISKVTGHADPEKPLTPDEKLQVVR
TQGALDVDAVAINTEVGIFKSQSIAKAVAERLKLVDDPYFRAQMEKKSFKTRITGWISKVTGHADPEKPLTPDEKLQVVR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLLGRNVTILNDGRSYLITVSVRTGRPDLSANIANAFSDVYLDFKRHMKIASTWRSNSLLDEQIIPLRERLRKAEQAVEQ
DLLGRNVTILNDGRSYLITVSVRTGRPDLSANIANAFSDV                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YREKNGLISAEITHSGSPNAPAGVTVTDQQLVETNRALVAAQADLTAKRARANQMMGNTASTTDVLSSPIIQQLQAQEAM


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNARVASLASTAGDANPELQAARAAAAHVRAQIGQVTSQITTSTDKDLRSAERRVAALTDEVTKLQEHVGRENEANVTLQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLESEAAAARAVYQDFLGRYAQTSSAAALQEPEAELISRADQPLGVSGPPRTQFMAIAILFSALAGVGVAIAQERMQKGV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEGTEIDAVPGLFTLGMVPSFSHSLSELYRSSQPSIYIESIEAIRTILSFGRSRFRAKTITVTSSGPEEGKTVFALSLAA
                                                              TSSGPEEGKTVFALSLAA
                                                                     GKT        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTGRAGKKALILDCDTRGPSALEIVQASGKGKGERHLVTSLDKRGLSRDVLPGVDVMTMNNWKSPSDQMIVPEVLQVVLA
NTGRAGKKALILDCDTRGPSALEIVQASGKGKGERHLVTSLDKRGLSRDVLPGVDVMTMNNWKSPSDQMIVPEVLQVVLA
         LILDCDTR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELSPHYDLIILDTPPLLAFPDAAVLSHETDGVVLVVKWGVTTQENLKGAMRQLEAYDARTLGAVLTQVPAGSASGLSGAA
ELSPHYDLIILDTPPLLAFPDAAVLSHETDGVVLVVKWGVTTQENLKGAMRQLEAYDARTLGAVLTQVPAGSASGLSGAA
        IILDTPP                                                                 
       730  
....:....|..
LQVYRHYGLLAS
LQVYRHYGLL  
   YRHY     

© 1998-2019