BYKdb

Annotate results for A0A0D6Z6K9

A0A0D6Z6K9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D6Z6K9
DOMAINcd48/228TSSGPSEGKSTTAANLAVVFAQQEKQVLLVDADLRKPTVHYTFNLTNTFGLTSVLSKQMQ
LVEAVDESEIDNLGILTSGPIPPNPAELLGSKAMNQFLLEAREHFDVILFDTPPVLAVTD
AQVLANKCDGSILVVYSGRTEMDGAAKAKELLENAKSKLLGVVLNHKKLQSSDYYYYYGN
K
SITEWalker A55/57GKS
SITEWalker A'75/82LLVDADLR
SITEWalker B155/161ILFDTPP
SITEY Cluster221/225YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKAMASTKRMLVTFLDPKSPISEQYRTIRTNIEFSSIDEDMQAIMVTSSGPSEGKSTTAANLAVVFAQQEKQVLLVDAD
                                               TSSGPSEGKSTTAANLAVVFAQQEKQVLLVDAD
                                                      GKS                 LLVDAD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRKPTVHYTFNLTNTFGLTSVLSKQMQLVEAVDESEIDNLGILTSGPIPPNPAELLGSKAMNQFLLEAREHFDVILFDTP
LRKPTVHYTFNLTNTFGLTSVLSKQMQLVEAVDESEIDNLGILTSGPIPPNPAELLGSKAMNQFLLEAREHFDVILFDTP
LR                                                                        ILFDTP
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
PVLAVTDAQVLANKCDGSILVVYSGRTEMDGAAKAKELLENAKSKLLGVVLNHKKLQSSDYYYYYGNK
PVLAVTDAQVLANKCDGSILVVYSGRTEMDGAAKAKELLENAKSKLLGVVLNHKKLQSSDYYYYYGNK
P                                                           YYYYY   
© 1998-2019