BYKdb

Annotate results for A0A0D7NEE8

A0A0D7NEE8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D7NEE8
DOMAINtad21/197ISDAILALKGLVSRQLPLMIFVFLACVSLALLYVITAQRMYTSTASLIIDSRKISLMQQQ
QSAGSDAPIESAMIDSQVEIIKSDTIALSVIKDLRLVDEPEFTGDSGGLIGNVVGAVFSL
ISSPTPPSEYQQLRKALSRFAKNLTVKRVGLSYVIEISYRSNSADRAAQISNAVAEA
DOMAINcd602/791TSSLPNEGKSTIAGAIAQASSMSGTRTLLVDCDIRNPSLTRRFSPDAQAGIVELVLGQAE
LKDLIWTDSQSALHFLPCVLASRSSNSADLLASAPMERLFKALRSHYDLIIVDMSPLAPV
IDVRGTSRIVDHYTLVVEWAQTKIDIVKRSLDEAPGVQKKLMGVVLNKVDIGALGRYDSH
RGDYYRNRYY
SITEWalker A609/611GKS
SITEWalker A'629/636LLVDCDIR
SITEWalker B711/717IIVDMSP
SITEY Cluster785/796YYRNRYYHRYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLHSRLPSVNVEAPEPELLSISDAILALKGLVSRQLPLMIFVFLACVSLALLYVITAQRMYTSTASLIIDSRKISLMQQQ
                    ISDAILALKGLVSRQLPLMIFVFLACVSLALLYVITAQRMYTSTASLIIDSRKISLMQQQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSAGSDAPIESAMIDSQVEIIKSDTIALSVIKDLRLVDEPEFTGDSGGLIGNVVGAVFSLISSPTPPSEYQQLRKALSRF
QSAGSDAPIESAMIDSQVEIIKSDTIALSVIKDLRLVDEPEFTGDSGGLIGNVVGAVFSLISSPTPPSEYQQLRKALSRF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKNLTVKRVGLSYVIEISYRSNSADRAAQISNAVAEAYIVDSLEAKYNASRRAAVWLQDRMKELRVQASAAERGVADYKA
AKNLTVKRVGLSYVIEISYRSNSADRAAQISNAVAEA                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNNIVDAGGRLLSEQQLAEINSALTVARAQRAEAQARLERITTILKADDEDRNVILNDLATVADTMQNPVIVKLRQTYLD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YAAKESDWSNRYGANHLAVINLRNQMREIRRSIKDELKRTAESFKSDLEIAKSREEASQKSLSDAINQSNDTSQAQIVLR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLESNAQSARALSDNFLQMYMVSVQQQSFPITEARVITPAAMSLSPSSPKTLLVLLGSLLVGGLFAAASGFVRDMMDRVF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTAPQVEAMLGVSCLAVVPRVLPDELPQSGWSKARTVAKLARISGWRHLRGKNEPEQQVVASIGSEYPAGAQLPSRQMNI


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDTMSGVVTRAPFSRFAEAMRAVKMAIDLSRDEATCKVIGITSSLPNEGKSTIAGAIAQASSMSGTRTLLVDCDIRNPSL
                                         TSSLPNEGKSTIAGAIAQASSMSGTRTLLVDCDIRNPSL
                                                GKS                 LLVDCDIR    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRRFSPDAQAGIVELVLGQAELKDLIWTDSQSALHFLPCVLASRSSNSADLLASAPMERLFKALRSHYDLIIVDMSPLAP
TRRFSPDAQAGIVELVLGQAELKDLIWTDSQSALHFLPCVLASRSSNSADLLASAPMERLFKALRSHYDLIIVDMSPLAP
                                                                      IIVDMSP   
       730       740       750       760       770       780       790        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
VIDVRGTSRIVDHYTLVVEWAQTKIDIVKRSLDEAPGVQKKLMGVVLNKVDIGALGRYDSHRGDYYRNRYYHRYGYVD
VIDVRGTSRIVDHYTLVVEWAQTKIDIVKRSLDEAPGVQKKLMGVVLNKVDIGALGRYDSHRGDYYRNRYY       
                                                                YYRNRYYHRYGY  

© 1998-2019