BYKdb

Annotate results for A0A0D7PKL6

A0A0D7PKL6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D7PKL6
DOMAINtad22/197SSQSLSSYVNMVRRQFPTVLAVASACIILALLYLFTATPEYTSTASMVIDSRKIQLFQQQ
SALGDIALDSASVETQVEILKSENISLAVVRDLHLVDDPEFTGGGGGLLGAIVGSVARLF
SSPTPQSEYQLTRRALARFEGNRTIKRLGQTYVMEVGFTSRDPVKAGIVANAIADA
DOMAINcd552/743TSALPNEGKSTVSTNLAQLMAHGGARVVLVDADLRNPSLSRALAPDAEVGLLDVIAQKLQ
LEDVLKIDAQTGLAVLPVVATSKLLHTNEILASKRMHDLIATLRSKFDYVVLDLPPMAPV
VDVRVTSTFVDTYILVVEWGKTKMDVVMHNLRNSPEIQDKMLGVILNKADTNLLSRYESH
QGRYYYQKYYSR
SITE-691/-693GKT
SITEWalker A'579/586VLVDADLR
SITEWalker B661/667VVLDLPP
SITEY Cluster735/746YYYQKYYSRYGY
SITEWalker A559/561GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLKVHKSTSEINQEFVEVDSSSSQSLSSYVNMVRRQFPTVLAVASACIILALLYLFTATPEYTSTASMVIDSRKIQLFQQ
                     SSQSLSSYVNMVRRQFPTVLAVASACIILALLYLFTATPEYTSTASMVIDSRKIQLFQQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSALGDIALDSASVETQVEILKSENISLAVVRDLHLVDDPEFTGGGGGLLGAIVGSVARLFSSPTPQSEYQLTRRALARF
QSALGDIALDSASVETQVEILKSENISLAVVRDLHLVDDPEFTGGGGGLLGAIVGSVARLFSSPTPQSEYQLTRRALARF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGNRTIKRLGQTYVMEVGFTSRDPVKAGIVANAIADAYIVDQLEAKYQSTRRASVWLQDRIKELRTQASTAQRAVVDFKT
EGNRTIKRLGQTYVMEVGFTSRDPVKAGIVANAIADA                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANKIVDTGGRLMNEQQLAEVNSQLVLTHAGTAEAKARLDRMNDIVRQEIPDASVADALKNETIVKLRGQYVDMAAKEAIW


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SARYGRDHMAAVNLRTQMTEIKKNIVDELKRIQESYKSDYDIAVTREESIKTSLNTVVSESQLTNQAQVQLREFESNAQS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YQAMYDNFLQKYMESVQQQSFPITEARVISAASTPLVKTYPKSFVVLAASLLGGILLGLGAAVARELTDNVFRTTSQVQE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLGANCLAILPAILPEGQQRTILGARRTDKNVPLLQYVVEHPLSRFSEAIRSLKVSLDLNSIVRENRVLAVTSALPNEGK
                                                                       TSALPNEGK
                                                                              GK
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STVSTNLAQLMAHGGARVVLVDADLRNPSLSRALAPDAEVGLLDVIAQKLQLEDVLKIDAQTGLAVLPVVATSKLLHTNE
STVSTNLAQLMAHGGARVVLVDADLRNPSLSRALAPDAEVGLLDVIAQKLQLEDVLKIDAQTGLAVLPVVATSKLLHTNE
S                 VLVDADLR                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILASKRMHDLIATLRSKFDYVVLDLPPMAPVVDVRVTSTFVDTYILVVEWGKTKMDVVMHNLRNSPEIQDKMLGVILNKA
ILASKRMHDLIATLRSKFDYVVLDLPPMAPVVDVRVTSTFVDTYILVVEWGKTKMDVVMHNLRNSPEIQDKMLGVILNKA
                    VVLDLPP                                                     
       730       740        
....:....|....:....|....:...
DTNLLSRYESHQGRYYYQKYYSRYGYLE
DTNLLSRYESHQGRYYYQKYYSR     
              YYYQKYYSRYGY  

© 1998-2019