BYKdb

Annotate results for A0A0D7QNC0

A0A0D7QNC0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D7QNC0
DOMAINtad22/197LEQTISTAITLIGRQYPVMIFVMCICIGLAGVYLLTAPKQYTGTAVLLIDSRKMQGLQTQ
APTGGDSPIDSAMVDSQVEVLKSETIATSVIKELHLLDSPEFTGKEGGMLGSISNLFSWI
FPESPPSEAALTRTAIGKLAGNLTIKRVGLSYVIEISYQSRSPDQAARVANAVADG
DOMAINcd609/801TSGLPNEGKSTISEALAQTVAQAGSRTLLIDGDIRNPSLTARLAPSAQVGLIDVVVGRVD
WKDAVWIDPQTNLHFLPCVVTSRFSNSSDVLASPQMERLFQHLREHYDRIVLDLSPLAPV
IDVRATGALADSYVLVIEWAKAKVDIVERVLNETPIVRERLLGAVLNKVNMAVMSRYDIY
SASYYRNRYYKRY
SITEWalker A616/618GKS
SITEWalker A'636/643LLIDGDIR
SITEWalker B718/724IVLDLSP
SITEY Cluster785/803YDIYSASYYRNRYYKRYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQTRITPPREIESPKQQSASLEQTISTAITLIGRQYPVMIFVMCICIGLAGVYLLTAPKQYTGTAVLLIDSRKMQGLQT
                     LEQTISTAITLIGRQYPVMIFVMCICIGLAGVYLLTAPKQYTGTAVLLIDSRKMQGLQT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAPTGGDSPIDSAMVDSQVEVLKSETIATSVIKELHLLDSPEFTGKEGGMLGSISNLFSWIFPESPPSEAALTRTAIGKL
QAPTGGDSPIDSAMVDSQVEVLKSETIATSVIKELHLLDSPEFTGKEGGMLGSISNLFSWIFPESPPSEAALTRTAIGKL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGNLTIKRVGLSYVIEISYQSRSPDQAARVANAVADGYIVDSLESKYQASRRAAVWLQDRLKELRTQASTAERAVADFKA
AGNLTIKRVGLSYVIEISYQSRSPDQAARVANAVADG                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNNIVDAGGRLLTEQQLAEINSSLTQARGQRAEAQAKLERITSILNADDNDAKVILNDLATVTDTMNNPVITKLRQTYLD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YAAREADWSNRYGPTHLAVVNLRNQMREIRHSITEELRRTAEVYKSDLAIAKAREESSQKSLNDTIALSNGTSQAQIVLR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLDSNAQSARALSDNFLQLYMVSVQQQSFPITESRVITQASNAPNKTSPKTMLILLATLIGGTILAGLVAVLLDMMDRVF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTVSQVEQLLHTSCLASIPAIGSEQSVGVAGHSLMSRAARRFNRRPKRPQPLAAKPAPSVATAGLPLRKSELGSNHPQPH


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDRLLKANDSVGRYVINAPFSRFSEGFRSIKLATDLSSYGSSNKVIGITSGLPNEGKSTISEALAQTVAQAGSRTLLIDG
                                                TSGLPNEGKSTISEALAQTVAQAGSRTLLIDG
                                                       GKS                 LLIDG
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIRNPSLTARLAPSAQVGLIDVVVGRVDWKDAVWIDPQTNLHFLPCVVTSRFSNSSDVLASPQMERLFQHLREHYDRIVL
DIRNPSLTARLAPSAQVGLIDVVVGRVDWKDAVWIDPQTNLHFLPCVVTSRFSNSSDVLASPQMERLFQHLREHYDRIVL
DIR                                                                          IVL
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLSPLAPVIDVRATGALADSYVLVIEWAKAKVDIVERVLNETPIVRERLLGAVLNKVNMAVMSRYDIYSASYYRNRYYKR
DLSPLAPVIDVRATGALADSYVLVIEWAKAKVDIVERVLNETPIVRERLLGAVLNKVNMAVMSRYDIYSASYYRNRYYKR
DLSP                                                            YDIYSASYYRNRYYKR
     
....:
YGYVD
Y    
YGY  

© 1998-2019