BYKdb

Annotate results for A0A0D8BLB2

A0A0D8BLB2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D8BLB2
DOMAINtad1/136MALMFYLRAVRAHWLVALGVFAMCSVTTGLYVSVQSPIYTAKIQLFVATSSEGASATQLY
EASNFSVERVKSYVRIINSPDVMQAVVNQLRLDQTAEQLAGSVNASTPVDTVLIDVSVTD
RSPRGAQEIANAIGAQ
DOMAINcd267/455TSALASEGKSLIAGNLAIMMARAGERVVLVDGDLRRPRLAEAFSLPGSVGLTSVLVGNVP
ISRALRQWRDDIPLYLLPSGPIPPNPSELLSSTQFAEIVGELVNSGFVVVFDSPPLLPVT
DAALIGRVTGGVLLVAQMKKVRSEQLASASQTLRAAGVNILGVIANRVTKSERVYGYDSI
PDSVSAHQT
SITEWalker A274/276GKS
SITEWalker A'294/301VLVDGDLR
SITEWalker B375/381VVFDSPP
SITEY Cluster441/443YGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALMFYLRAVRAHWLVALGVFAMCSVTTGLYVSVQSPIYTAKIQLFVATSSEGASATQLYEASNFSVERVKSYVRIINSP
MALMFYLRAVRAHWLVALGVFAMCSVTTGLYVSVQSPIYTAKIQLFVATSSEGASATQLYEASNFSVERVKSYVRIINSP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVMQAVVNQLRLDQTAEQLAGSVNASTPVDTVLIDVSVTDRSPRGAQEIANAIGAQFPAVVGRIETPNGGQISPXKVSVT
DVMQAVVNQLRLDQTAEQLAGSVNASTPVDTVLIDVSVTDRSPRGAQEIANAIGAQ                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSASLPAAPSSPRKKVDLLLGVLVGLALGVGTAVVRYRVDRRVRTEAEVSRIVRAPVIGALANDRRINERAPAVDQLSGS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAEELRRLRTNIGFLSIDRKLSSFVITSALASEGKSLIAGNLAIMMARAGERVVLVDGDLRRPRLAEAFSLPGSVGLTSV
                          TSALASEGKSLIAGNLAIMMARAGERVVLVDGDLRRPRLAEAFSLPGSVGLTSV
                                 GKS                 VLVDGDLR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVGNVPISRALRQWRDDIPLYLLPSGPIPPNPSELLSSTQFAEIVGELVNSGFVVVFDSPPLLPVTDAALIGRVTGGVLL
LVGNVPISRALRQWRDDIPLYLLPSGPIPPNPSELLSSTQFAEIVGELVNSGFVVVFDSPPLLPVTDAALIGRVTGGVLL
                                                      VVFDSPP                   
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAQMKKVRSEQLASASQTLRAAGVNILGVIANRVTKSERVYGYDSIPDSVSAHQTTRRPAYDVVRHDDGLDLATTIIERK
VAQMKKVRSEQLASASQTLRAAGVNILGVIANRVTKSERVYGYDSIPDSVSAHQT                         
                                        YGY                                     
         
....:....
PSPERFPSS


© 1998-2019