BYKdb

Annotate results for A0A0D8J3F4

A0A0D8J3F4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0D8J3F4
DOMAINcd35/225TSAIPGEGKSSVALNLAVSLAETGSRVLVIDCDLRKPVIHRYLKIDNSAYKGIISALADG
SLAESIINVKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIFDTPPVSVVT
DAAVLSQYADGVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYY
YSYNYSYENAD
SITEWalker A42/44GKS
SITEWalker A'62/69LVIDCDLR
SITEWalker B143/149IIFDTPP
SITE-140/-142YEY
SITEY Cluster213/221YYYSYNYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKNAPFQYQEAYKSLRTNLNFMAMGKACKKLIFTSAIPGEGKSSVALNLAVSLAETGSRVLVIDCDLRKPVIHRYLKID
                                  TSAIPGEGKSSVALNLAVSLAETGSRVLVIDCDLRKPVIHRYLKID
                                         GKS                 LVIDCDLR           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSAYKGIISALADGSLAESIINVKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIFDTPPVSVVTDAAVLS
NSAYKGIISALADGSLAESIINVKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIFDTPPVSVVTDAAVLS
                                                              IIFDTPP           
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
QYADGVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYYYSYNYSYENADR
QYADGVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYYYSYNYSYENAD 
                                                    YYYSYNYSY     
© 1998-2019