BYKdb

Annotate results for A0A0D9AQH4

A0A0D9AQH4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0D9AQH4
DOMAINtad22/199DFIDLKKIWHAIWSRKWGIVLLVAIVALLTFFLLSRVTPIYKAVTSVLIETKGTPVLSFQ
PAADTPVELSEYLQTQLSLMQSRGVAERVVRDLNLTEHPEFDLRQQPGPLVDFSGIVDAL
TGEEPEPLTEAQIIDYATQTFMDRTTVWVEGKSQLVYLSIAMADRLTAAQATNQLAQA
DOMAINcd543/731TSTAPDEGKSSVSANLAFAMGQLHRVLLIDADLRRATLDKAFDFKPGTPGLVNLIGGNAK
LEECIHSVGNVDMIAAGSVPSNPLELLSSPRFAKLLEVVKGRYDRIIIDSPPSQAVSDAA
VLSTLADAVIYVVKSDSTLIPHVQKGVSQLQNSNAPITGVVLNHVDIEKAKKNGQFRGYY
DHYGYSEQT
SITEWalker A550/552GKS
SITEWalker A'569/576LLIDADLR
SITEWalker B648/654IIIDSPP
SITEY Cluster721/727YYDHYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSPVRPDRPWQRPVGPAADSDFIDLKKIWHAIWSRKWGIVLLVAIVALLTFFLLSRVTPIYKAVTSVLIETKGTPVLSF
                     DFIDLKKIWHAIWSRKWGIVLLVAIVALLTFFLLSRVTPIYKAVTSVLIETKGTPVLSF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPAADTPVELSEYLQTQLSLMQSRGVAERVVRDLNLTEHPEFDLRQQPGPLVDFSGIVDALTGEEPEPLTEAQIIDYATQ
QPAADTPVELSEYLQTQLSLMQSRGVAERVVRDLNLTEHPEFDLRQQPGPLVDFSGIVDALTGEEPEPLTEAQIIDYATQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TFMDRTTVWVEGKSQLVYLSIAMADRLTAAQATNQLAQAYIEAQLEAKVDMSMTAASWMNERLVSLRQKLQDSEDRLQAY
TFMDRTTVWVEGKSQLVYLSIAMADRLTAAQATNQLAQA                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDAEGLVDLDGVGTISANELSLTGDRMIDARRQRAEAESQYRQVESMRSQGWERLASVPAVLGHPLIQQFKADQAHARSR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEDLSRRYGDRHPAMASARSDLNAATASLKQQVEQVVASIERNYQLAVANENSLRASFDENKGRIQDISRKEFKVRDLQR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVESDRALYDTFMTRLQETTATSDLSSTNARIVDAAIPPTEPSAPNKKLIMVVALFLALVVGIAQAIIREILDNTFKSSE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVETKLGLPVMGIVPQVPRKMRKEVSHLFERSSDKRFCEAVRTIRTNLLLSEANQPRQVLVVTSTAPDEGKSSVSANLAF
                                                              TSTAPDEGKSSVSANLAF
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMGQLHRVLLIDADLRRATLDKAFDFKPGTPGLVNLIGGNAKLEECIHSVGNVDMIAAGSVPSNPLELLSSPRFAKLLEV
AMGQLHRVLLIDADLRRATLDKAFDFKPGTPGLVNLIGGNAKLEECIHSVGNVDMIAAGSVPSNPLELLSSPRFAKLLEV
        LLIDADLR                                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKGRYDRIIIDSPPSQAVSDAAVLSTLADAVIYVVKSDSTLIPHVQKGVSQLQNSNAPITGVVLNHVDIEKAKKNGQFRG
VKGRYDRIIIDSPPSQAVSDAAVLSTLADAVIYVVKSDSTLIPHVQKGVSQLQNSNAPITGVVLNHVDIEKAKKNGQFRG
       IIIDSPP                                                                  
       730  
....:....|..
YYDHYGYSEQTV
YYDHYGYSEQT 
YYDHYGY     

© 1998-2019