BYKdb

Annotate results for A0A0E2BPF2

A0A0E2BPF2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0E2BPF2
DOMAINcd59/246TSAAAAEGKSTVSSNVAVTFAKQGLNTILVDLDMRRPMVNATFGQQNIGGLVKLLTTDGE
KLEEQLPLYAKPTQIENLTVLVAGPTPPNPSELLGSKSMLALLKYLREHYDRVVLDTPPV
LSVTDAQIVAAHADATVLVVPYGLAQKKFVLQAKDLLTKVDANIIGVVMNRMPAQGGAGY
YYYGGYYK
SITEWalker A66/68GKS
SITEWalker A'86/93ILVDLDMR
SITEWalker B171/177VVLDTPP
SITE-163/-168YLREHY
SITEY Cluster238/245YYYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAWFKRKNKKALADRSLKQGVALVTNYAPDSRISEEYRTLRTNISFSQADGDIKTLVITSAAAAEGKSTVSSNVAVTFAK
                                                          TSAAAAEGKSTVSSNVAVTFAK
                                                                 GKS            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGLNTILVDLDMRRPMVNATFGQQNIGGLVKLLTTDGEKLEEQLPLYAKPTQIENLTVLVAGPTPPNPSELLGSKSMLAL
QGLNTILVDLDMRRPMVNATFGQQNIGGLVKLLTTDGEKLEEQLPLYAKPTQIENLTVLVAGPTPPNPSELLGSKSMLAL
     ILVDLDMR                                                                   
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKYLREHYDRVVLDTPPVLSVTDAQIVAAHADATVLVVPYGLAQKKFVLQAKDLLTKVDANIIGVVMNRMPAQGGAGYYY
LKYLREHYDRVVLDTPPVLSVTDAQIVAAHADATVLVVPYGLAQKKFVLQAKDLLTKVDANIIGVVMNRMPAQGGAGYYY
          VVLDTPP                                                            YYY
      
....:.
YGGYYK
YGGYYK
YGGYY 
© 1998-2019