BYKdb

Annotate results for A0A0E2H9X6

A0A0E2H9X6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0E2H9X6
DOMAINcd41/232TSSLPDEGKSDITFAMASSLAQIGKKVVMIDADIRKSVLVSRYQLEREVSGLSQYLSGQR
SLENVIYDTNIENFSMIFAGPYSPNPAELLEESLFGDMISKLKERYDYIIVDTPPMGNLI
DGAIVARQCDGAVMVIESGSISYRLEQRVKGQLEKSGCRILGVVLNKVNMERNGYYSKYY
GKYGKYSKYGHY
SITEWalker A48/50GKS
SITEWalker A'68/75VMIDADIR
SITEWalker B149/155IIVDTPP
SITE-146/-148YDY
SITEY Cluster215/238YYSKYYGKYGKYSKYGHYGKYDRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQFVTLNRIMKDDYHYNEAIKTLRTNIQFCGSGIKTIMLTSSLPDEGKSDITFAMASSLAQIGKKVVMIDADIRKSVLV
                                        TSSLPDEGKSDITFAMASSLAQIGKKVVMIDADIRKSVLV
                                               GKS                 VMIDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRYQLEREVSGLSQYLSGQRSLENVIYDTNIENFSMIFAGPYSPNPAELLEESLFGDMISKLKERYDYIIVDTPPMGNLI
SRYQLEREVSGLSQYLSGQRSLENVIYDTNIENFSMIFAGPYSPNPAELLEESLFGDMISKLKERYDYIIVDTPPMGNLI
                                                                    IIVDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGAIVARQCDGAVMVIESGSISYRLEQRVKGQLEKSGCRILGVVLNKVNMERNGYYSKYYGKYGKYSKYGHYGKYDRYGK
DGAIVARQCDGAVMVIESGSISYRLEQRVKGQLEKSGCRILGVVLNKVNMERNGYYSKYYGKYGKYSKYGHY        
                                                      YYSKYYGKYGKYSKYGHYGKYDRY  
   
...
AEA


© 1998-2019