BYKdb

Annotate results for A0A0E2I0A8

A0A0E2I0A8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0E2I0A8
DOMAINcd48/226TSAGPEEGKSTVSANLAIVFANSGKKTLLIDADLRKPSVESTFRSTSNSDGLTNLLKKRN
ESAFVFIHETNIAHLWTMTSGPKPPNPSELLESSRMNEIIDELSVNFDLIIFDLPPVVPV
TDAQILASKTDGTIIVVRERKTLKQELFKAKELLTIAQANILGIVYNGVKKSKDINYYY
SITEWalker A55/57GKS
SITEWalker A'75/82LLIDADLR
SITEWalker B157/163IIFDLPP
SITEY Cluster224/226YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKNNMKKKGVPLISASKQSSMISEQYRTVRSNIQFSSFDQDIKTIVVTSAGPEEGKSTVSANLAIVFANSGKKTLLIDAD
                                               TSAGPEEGKSTVSANLAIVFANSGKKTLLIDAD
                                                      GKS                 LLIDAD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRKPSVESTFRSTSNSDGLTNLLKKRNESAFVFIHETNIAHLWTMTSGPKPPNPSELLESSRMNEIIDELSVNFDLIIFD
LRKPSVESTFRSTSNSDGLTNLLKKRNESAFVFIHETNIAHLWTMTSGPKPPNPSELLESSRMNEIIDELSVNFDLIIFD
LR                                                                          IIFD
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
LPPVVPVTDAQILASKTDGTIIVVRERKTLKQELFKAKELLTIAQANILGIVYNGVKKSKDINYYY
LPPVVPVTDAQILASKTDGTIIVVRERKTLKQELFKAKELLTIAQANILGIVYNGVKKSKDINYYY
LPP                                                            YYY
© 1998-2019