BYKdb

Annotate results for A0A0E2URZ9

A0A0E2URZ9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0E2URZ9
DOMAINcd41/233TSVQPGEGKSTTSANIAISFAKAGLKTLLIDADIRNSVMSGTFKADEKYEGLSSYLSGNA
ELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGS
YGANGNYGKPAKK
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADIR
SITEWalker B149/155VIIDTPP
SITE-89/-95YEGLSSY
SITEY Cluster215/227YGGYGSYGANGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARLELVKSKKELYDIAEEYYNSIRTNIQFSGRDLKVITLTSVQPGEGKSTTSANIAISFAKAGLKTLLIDADIRNSVMS
                                        TSVQPGEGKSTTSANIAISFAKAGLKTLLIDADIRNSVMS
                                               GKS                 LLIDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTFKADEKYEGLSSYLSGNAELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
GTFKADEKYEGLSSYLSGNAELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
                                                                    VIIDTPP     
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGSYGANGNYGKPAKKKSRKRR
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGSYGANGNYGKPAKK      
                                                      YGGYGSYGANGNY            
© 1998-2019