BYKdb

Annotate results for A0A0E3V905

A0A0E3V905 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0E3V905
DOMAINtad17/246DGLNIRALLSKYSKLWPWFILSTVLMLAIGHIYISNKQPIYKIQASLLVQDQQKGSEQSS
SLKELGVFAHKQVVENEIEILRSFTLMNRVADKLHLDVRYFQNTTFGKREIYTDSPIELI
VESGKPELYKKPLEVSMLSNKAVKINEQVYPVNHAIETPYGRLKIVTKKQTFDSENPYSI
QVTKRATSVKNYLTNLHAIPTGKGSTVILLSLEDAVPAKGEAILNQLIRE
DOMAINcd578/767TSSISGEGKSFVSINLGMSLAYVNKPTVILDMDLRAPKLHKVFCLNNSIGISDYLQGEAT
LDDVLTPVPGSTNYYVITSGNIPINPSELLSSPRLTQLITELRDRFDYIIIDTPPVGLVS
DARIIAPLVDTTFFMVRHNVTPKNHLRMIDKLHMDNRFPRLNIILNAVDGSDAYQYSNTQ
NEDYVYGKPG
SITEWalker A585/587GKS
SITEWalker A'605/612VILDMDLR
SITEWalker B686/692IIIDTPP
SITE-651/-652YY
SITEY Cluster751/763YQYSNTQNEDYVY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSANTYTYTQHQLVESDGLNIRALLSKYSKLWPWFILSTVLMLAIGHIYISNKQPIYKIQASLLVQDQQKGSEQSSSLKE
                DGLNIRALLSKYSKLWPWFILSTVLMLAIGHIYISNKQPIYKIQASLLVQDQQKGSEQSSSLKE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGVFAHKQVVENEIEILRSFTLMNRVADKLHLDVRYFQNTTFGKREIYTDSPIELIVESGKPELYKKPLEVSMLSNKAVK
LGVFAHKQVVENEIEILRSFTLMNRVADKLHLDVRYFQNTTFGKREIYTDSPIELIVESGKPELYKKPLEVSMLSNKAVK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INEQVYPVNHAIETPYGRLKIVTKKQTFDSENPYSIQVTKRATSVKNYLTNLHAIPTGKGSTVILLSLEDAVPAKGEAIL
INEQVYPVNHAIETPYGRLKIVTKKQTFDSENPYSIQVTKRATSVKNYLTNLHAIPTGKGSTVILLSLEDAVPAKGEAIL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQLIREYNEAAIMDKNKVAASTLKFIEDRLNIVSGELASAERNVEQYKSHQGITDLSVQAQTFLQTVQQNDALMNQVQIQ
NQLIRE                                                                          

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LATLNDLQKYIEGKGDTRGNTPAVVGLSDPVLLSLINNLTQLEQQRDHLLHTTSELNPLLETVDSQIKITKNNMASTILT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKNMLLSTQRQYVEKNGSVEGAIRTIPQKERVLMDITRQQAIKNSLYTYLLQKREETAVAFASTMADTRTIDTALSEDEP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRPNKSIIYALFSLLGLVIPIAVVASNDALNNRVTRRIDVEEVTQVPILGELVKKRQKGSLVITPKGQSVIAEQIRTLRA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CLPSLRNEATESQALLFTSSISGEGKSFVSINLGMSLAYVNKPTVILDMDLRAPKLHKVFCLNNSIGISDYLQGEATLDD
                 TSSISGEGKSFVSINLGMSLAYVNKPTVILDMDLRAPKLHKVFCLNNSIGISDYLQGEATLDD
                        GKS                 VILDMDLR                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLTPVPGSTNYYVITSGNIPINPSELLSSPRLTQLITELRDRFDYIIIDTPPVGLVSDARIIAPLVDTTFFMVRHNVTPK
VLTPVPGSTNYYVITSGNIPINPSELLSSPRLTQLITELRDRFDYIIIDTPPVGLVSDARIIAPLVDTTFFMVRHNVTPK
                                             IIIDTPP                            
       730       740       750       760       770    
....:....|....:....|....:....|....:....|....:....|....
NHLRMIDKLHMDNRFPRLNIILNAVDGSDAYQYSNTQNEDYVYGKPGRKKWILS
NHLRMIDKLHMDNRFPRLNIILNAVDGSDAYQYSNTQNEDYVYGKPG       
                              YQYSNTQNEDYVY           

© 1998-2019