BYKdb

Annotate results for A0A0E3YV65

A0A0E3YV65 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0E3YV65
DOMAINcd506/701TSTLPGEGKSFVASNLAASFASHGIKTLLVDTDFRRPTLHRYYGQSNDAGLLRWLDTKSK
TEPALLRDPALGITAFGPSLHLLRSGGTTRRSTEILDSAAFRDLLDFLHKQYDAVIIDTP
PAGVFSDAMVLAEQAGELVFVVRYNYTSRPGVRRLIETFKRSQIDLAGIVLNRMPAGTHS
DAYYSSYGHYGSKYAA
SITEWalker A513/515GKS
SITEWalker A'533/540LLVDTDFR
SITEWalker B620/626VIIDTPP
SITE-547/-548YY
SITE-649/-651YNY
SITEY Cluster688/703YYSSYGHYGSKYAADY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSPREILLSIRERALTSFVLALLICSLLGGWLLSRPKVYQSRSRLLVDRSERVVDIAQVVDQSVGGGKNDAMFDTYLAQI


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSPAMIVRVVDSLSETEKLSAWRPYAEQDAPPPAAPVLRDTLLQIIGSSVSAARQGNTFFISINVLQRDPDSAALLASRF


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASQFIIHLLDRNSAVNNSAIAFLREQTQELRVKAESSERALQQYREKSGMVSLDESRNIVVDRMKALSSTVTGARVSRVT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEARLNQAEFIMAGGGDPLELAAATEFANLSAVQSQLDTLRTQRATMGERYGVRHPSMIENDRSREALERLRTELITAAM


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNLRNQRAKALNEETQLQSQLAQAEKESFRLDEMAVQFNVLRREAETNRATYAQLLNRLNETSITAQLANSNVRVADGGT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAGLPLEPDPRKIAITLLVLGLGVFVAYPVALELIFNRVKGWSDVENYLGLPLLAELPLLNKIKTEFLPHLLTRAADQDA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AETIRNLYGQLKAGSRLDLPKILLVTSTLPGEGKSFVASNLAASFASHGIKTLLVDTDFRRPTLHRYYGQSNDAGLLRWL
                         TSTLPGEGKSFVASNLAASFASHGIKTLLVDTDFRRPTLHRYYGQSNDAGLLRWL
                                GKS                 LLVDTDFR                    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTKSKTEPALLRDPALGITAFGPSLHLLRSGGTTRRSTEILDSAAFRDLLDFLHKQYDAVIIDTPPAGVFSDAMVLAEQA
DTKSKTEPALLRDPALGITAFGPSLHLLRSGGTTRRSTEILDSAAFRDLLDFLHKQYDAVIIDTPPAGVFSDAMVLAEQA
                                                           VIIDTPP              
       650       660       670       680       690       700         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
GELVFVVRYNYTSRPGVRRLIETFKRSQIDLAGIVLNRMPAGTHSDAYYSSYGHYGSKYAADYIREEKA
GELVFVVRYNYTSRPGVRRLIETFKRSQIDLAGIVLNRMPAGTHSDAYYSSYGHYGSKYAA        
                                               YYSSYGHYGSKYAADY      

© 1998-2019